DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNOT8 and Pop2

DIOPT Version :9

Sequence 1:NP_001288002.1 Gene:CNOT8 / 9337 HGNCID:9207 Length:292 Species:Homo sapiens
Sequence 2:NP_001287041.1 Gene:Pop2 / 39366 FlyBaseID:FBgn0036239 Length:361 Species:Drosophila melanogaster


Alignment Length:253 Identity:172/253 - (67%)
Similarity:213/253 - (84%) Gaps:9/253 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     1 MPAA--------LVENSQV-ICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRS 56
            ||:|        :..|.:. |.:||..|||||.|.||::|..|.|:||||||||||.||:|||||
  Fly     5 MPSAISGAPHAHIPSNEECGIRDVWKQNLEEEFRTIRKVVQKYHYVAMDTEFPGVVARPVGEFRS 69

Human    57 SIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGL 121
            :.||.|||||||||||:||||||||.::.|:.|.|.:||||||||||:||||:|||||||.|||:
  Fly    70 TADYHYQLLRCNVDLLRIIQLGLTFMDDDGKTPPGYSTWQFNFKFNLSEDMYAQDSIDLLQNSGI 134

Human   122 QFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILN 186
            ||:||||:|||.:.||||||:||:||.:|:|||.|||||||||::|||||..||.:|.|||.:|:
  Fly   135 QFKKHEEDGIDPIDFAELLMSSGIVLVENIKWLCFHSGYDFGYLLKLLTDQNLPPDESEFFDLLH 199

Human   187 LFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKEL 244
            ::||:|:|:|||||||||||||||||||||:|:|:|.|||||||:||||||||:|:|:
  Fly   200 IYFPNIFDIKYLMKSCKNLKGGLQEVADQLELRRVGPQHQAGSDALLTGMAFFKMREV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNOT8NP_001288002.1 CAF1 1..263 CDD:420020 172/253 (68%)
Pop2NP_001287041.1 CAF1 25..257 CDD:304961 167/231 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159564
Domainoid 1 1.000 195 1.000 Domainoid score I3148
eggNOG 1 0.900 - - E1_COG5228
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 376 1.000 Inparanoid score I2095
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54002
OrthoDB 1 1.010 - - D365788at33208
OrthoFinder 1 1.000 - - FOG0001271
OrthoInspector 1 1.000 - - otm40815
orthoMCL 1 0.900 - - OOG6_101138
Panther 1 1.100 - - O PTHR10797
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R161
SonicParanoid 1 1.000 - - X785
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.