DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD163 and Corin

DIOPT Version :9

Sequence 1:NP_004235.4 Gene:CD163 / 9332 HGNCID:1631 Length:1156 Species:Homo sapiens
Sequence 2:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster


Alignment Length:512 Identity:111/512 - (21%)
Similarity:163/512 - (31%) Gaps:183/512 - (35%)


- Green bases have known domain annotations that are detailed below.


Human   181 GTVCDDNFNIDHASVICRQLECGSAVSFSGSSNFGEGSGPIWFDDLICNGNESALWNCKHQGWGK 245
            |..||.|..:....|....|:|......:..    |..||   |::.| |:...:..       |
  Fly   912 GFQCDQNRCLPQEYVCDGHLDCMDQADEAKC----ERCGP---DEIYC-GDSQCIGT-------K 961

Human   246 HNCDHAEDAGVI-CSKGAD------LSLRLVDGVTECSGRLEV-RF-QGEWGTICDDGWDSYDAA 301
            |.||     |:| |..|.|      ||.|..|..|   |.||| |. |.:|...|...|   |.|
  Fly   962 HICD-----GIIDCPYGQDERNC
LRLSERNGDVGT---GVLEVYRIGQRQWMPACVKNW---DRA 1015

Human   302 VACKQLGCPTAVTAIGRVNASKGFGHIWLDSVSCQ-GHEPA---------IWQCKHHEWGKHYCN 356
            |:      |:||.:|      .|:..:...||..| .|.|.         ||        |.|..
  Fly  1016 VS------PSAVCSI------LGYSAVNATSVLTQLTHRPLLATVNVSTDIW--------KMYAK 1060

Human   357 HNEDAGVTCSDGSDLELRLRGGGSRCAGTVEVEIQRLLGKVCDRGWGLKEADVVCRQLGCGSAL- 420
            ..                         .|:..|...     |.:......||:.|....||... 
  Fly  1061 RK-------------------------STLMQEFAN-----CKKTEDYPMADLTCS
NYECGRVKR 1095

Human   421 ---KTSYQVYSKIQAT-NTWLFLSSCNGNETSLWDCK----NWQWGGLTCDH---------YEEA 468
               |.|.::....||: ..|.||::..|....::.|.    :.|| .||..|         .|:.
  Fly  1096 GRHKPSRRIIGGTQASPGNWPFLAAILGGPEKIFYCAGVLISDQW-VLTASHCVGNYSVIDLEDW 1159

Human   469 KITCSAHREPRLVGGDIPCSG-RVEVK----HGDTWGSIC-DSDFSL----------EAASVLC- 516
            .|.....|.     .....|| :|:||    |.....:|. |:|.:|          |....:| 
  Fly  1160 TIQLGVTRR-----NSFTYSGQKVKVKAVIPHPQYNMAIAHDNDIALFQLATRVAFHEHLLPVCL 1219

Human   517 -----RELQCGTVVSILGGAHFGEGNGQIWAEEFQCEGHESHLSL-----CPVAPRPEGTCSHSR 571
                 |.|..||:.:::|           |.:....:...::..:     .|:..|.:  |....
  Fly  1220 PPPSVRNLHPGTLCTVIG-----------WGKREDKDPKSTYEYIVNEVQVPIITRNQ--CDEWL 1271

Human   572 D-----VGVVCSRYTEIRLVNGKTPCEG---------------RVELKTLGAWGSLC 608
            |     .|:||:.:.:    .||..|:|               |..:..:.:||.:|
  Fly  1272 DNLTVSEGMVCAGFDD----GGKDACQGDSGGPLLCPYPGEKNRWFVGGIVSWGIMC 1324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD163NP_004235.4 SR 51..152 CDD:214555
SRCR 56..152 CDD:278931
SR 159..259 CDD:214555 19/78 (24%)
SRCR 164..259 CDD:278931 19/78 (24%)
SR 266..366 CDD:214555 29/111 (26%)
SRCR 271..366 CDD:278931 27/106 (25%)
SR 373..473 CDD:214555 24/117 (21%)
SRCR 378..473 CDD:278931 24/112 (21%)
SR 479..578 CDD:214555 24/130 (18%)
SRCR 483..578 CDD:278931 24/126 (19%)
SR 583..683 CDD:214555 8/41 (20%)
SRCR 588..683 CDD:278931 8/36 (22%)
SR 719..819 CDD:214555
SRCR 724..819 CDD:278931
SR 929..1029 CDD:214555
SRCR 934..1029 CDD:278931
Internalization signal 1096..1099
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060 7/29 (24%)
LDLa 945..979 CDD:238060 14/49 (29%)
SR 980..>1034 CDD:214555 22/71 (31%)
SRCR 992..1086 CDD:278931 31/146 (21%)
Tryp_SPc 1103..1343 CDD:214473 48/245 (20%)
Tryp_SPc 1104..1346 CDD:238113 48/244 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.