DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MARS2 and MetRS

DIOPT Version :9

Sequence 1:NP_612404.1 Gene:MARS2 / 92935 HGNCID:25133 Length:593 Species:Homo sapiens
Sequence 2:NP_611382.1 Gene:MetRS / 37177 FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster


Alignment Length:586 Identity:146/586 - (24%)
Similarity:232/586 - (39%) Gaps:94/586 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    48 TTPIFYVNAAPHIGHLYSALL-ADALCRHRRLRGPSTAATRFSTGTDEHGLKIQQAAATAGLAPT 111
            |:.:.|||..||:|::...:| ||...|:.|..|.:|.   ...||||:|...:..|....|.|.
  Fly   259 TSALPYVNNVPHLGNIIGCVLSADIYARYSRSAGYNTL---LICGTDEYGTATENKALAENLTPR 320

Human   112 ELCDRVSEQFQQLFQEAGISCTDFIRTTEARHRVAVQH-FWGVLKSRGLLYKGVYEGWYCASDEC 175
            |:||:..|....:::..||....|.|||.......||. |..|||:..::.:.| |...|...:.
  Fly   321 EICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAFKDVLKAGYIITESV-EQLLCQKCDR 384

Human   176 FLPEAKV---TQQPG-----PSGDSFP---------------VSLESGHPVSWTKEENYIFRLSQ 217
            ||.:..|   ...||     ..||...               ..:.:..||..:.::.:| .|.:
  Fly   385 FLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNATELIRPRCKVCNSAPVLRSSDQLFI-DLPK 448

Human   218 FRKPLQRWLRGNPQAITPEPFHH---VVLQWLDEELPDLSVSRRSSHLHWGIPVP--GDDSQTIY 277
            ....|:.|:..:....|    |:   :...||.|.|....::|   .|.||||||  |.:.:..|
  Fly   449 AEPQLKEWVDKSEGGWT----HNAKVITRAWLKEGLKPRCITR---DLKWGIPVPHEGFEKKVFY 506

Human   278 VWLDALVNYLTVIGYPNAEFKSWW-PATS------HIIGKDILKFHAIYWPAFLL--GAGMSPPQ 333
            ||.||...|:::......|::.|| ||..      ..:.||.:.||::.||:.||  ..|.:...
  Fly   507 VWFDAPFGYVSMTKRYTKEYQQWWQPAKGTDVELFQFMAKDNVPFHSVVWPSVLLAINKGHTLVS 571

Human   334 RICVHSHWTVCGQKMSKSLG-NVVDPRTCLNRYTVDGFRYFLLRQGVPNWDCDYYDEKVVKLLNS 397
            .|....:......|.|||.| .|............|.:|::|........|..:....:....||
  Fly   572 HIMATEYLNYEDGKFSKSRGIGVFGNDAQETGIPADVWRFYLASARPEGQDSSFSWNDLAARNNS 636

Human   398 ELADALGGLLNRCTAKRINPSETYPAFCTTCFPSE-PGLVGPSVRAQAEDYALVSAVATLPKQVA 461
            ||.:.||..:||..           .||...|.|. ||::      ..:|..::  :|.:.:::.
  Fly   637 ELLNNLGNFVNRAL-----------VFCEKNFSSTVPGVI------TTQDELVL--LALINRELR 682

Human   462 DHYDNFRIYKALEAVSSCV---RQTNGFVQRHAPWKLNWESPVDAPWLGTVLHVALECLRVFGTL 523
            .:.::....|..:.|...:   |..||::|...||.|...:........|::.:.:....:...|
  Fly   683 GYINSMEKAKLRDGVRHLLAISRHGNGYMQSQQPWVLLKGTDDQKTRASTIIGLCVNIACLLANL 747

Human   524 LQPVTPSLADKLLSRLGVSA----SERSLGELYFLPRFY--GHPCPFEGRRLGPETGLLFPRLDQ 582
            |.|..|:.|..|..:|....    :|:.|..| .||..:  |.|.|            ||.:|:|
  Fly   748 LFPYMPTTARTLFGQLNAKQTPLNAEKPLVTL-LLPAGHQIGKPAP------------LFAKLEQ 799

Human   583 S 583
            |
  Fly   800 S 800

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MARS2NP_612404.1 PRK11893 46..581 CDD:237012 143/582 (25%)
'HIGH' region 52..62 5/9 (56%)
'KMSKS' region 347..351 2/3 (67%)
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 146/586 (25%)
MetRS_core 255..625 CDD:173907 100/377 (27%)
Anticodon_Ia_Met 634..763 CDD:153411 32/147 (22%)
MetRS_RNA 828..868 CDD:238475
MetRS_RNA 895..938 CDD:238475
MetRS_RNA 966..1009 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.