DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPR37L1 and CCHa1-R

DIOPT Version :9

Sequence 1:NP_004758.3 Gene:GPR37L1 / 9283 HGNCID:14923 Length:481 Species:Homo sapiens
Sequence 2:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster


Alignment Length:279 Identity:62/279 - (22%)
Similarity:110/279 - (39%) Gaps:46/279 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   124 TESSY-------SAYAIMLLALVVFAVGIVGNLSVMCIVWHSYYLKSAWNSILASLALWDFLVLF 181
            ||:.|       ..|.:.:|..::|.||::||.:::.:......:::..|:.:.||||.|.||:.
  Fly    68 TETPYVPYGRRPETYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVII 132

Human   182 FCLPIVIFNEITKQRLLGDVSCRAVPFMEVSSLGVTTFSLCALGIDRFHVATSTLPKVRP----I 242
            ..:|:.......:....|...|....||:..|:||:.|:|.||..||:......|.|...    .
  Fly   133 TTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGR 197

Human   243 ERCQSILAKLAVIWVGSMTLAVPELLLWQLAQEPAPTMGTLDSCIMKPSASLPESLYSLVMTYQN 307
            ...:..||....||:.::...:|.|:...|..     :|..:.              |:|:.|..
  Fly   198 RATRMTLATAVSIWLLAILCGLPALIGSNLKH-----LGINEK--------------SIVICYPY 243

Human   308 ARMW----------WYFGCYFCLPI----LFTVTCQLVTWRVRGPPGRKSECRASKHEQCESQLN 358
            ...|          .:|..|:.:|:    :|.|...|........||...  .|.:..:...::.
  Fly   244 PEEWGINYAKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQ--GAVRQVRARRKVA 306

Human   359 STVVGLTVVYAFCTLPENV 377
            .||:...|::..|.||.:|
  Fly   307 VTVLAFVVIFGICFLPYHV 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPR37L1NP_004758.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..58
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..108
7tm_1 147..397 CDD:278431 54/249 (22%)
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 27/99 (27%)
7tm_1 98..364 CDD:278431 54/249 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.