DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD9 and Tsp42Er

DIOPT Version :9

Sequence 1:XP_005253871.1 Gene:CD9 / 928 HGNCID:1709 Length:249 Species:Homo sapiens
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:177 Identity:44/177 - (24%)
Similarity:70/177 - (39%) Gaps:35/177 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    10 IKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVG 74
            |:||.|.|||:..:.|||.:.:.: :..|....          ......|:||.:  |:::.|:.
  Fly     8 IRYLAFLFNFLCAVLGIATIVVNV-IAIDQIAP----------KDQLILGLYIAV--GSIVFLLS 59

Human    75 FLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQ 139
            |.||.||::||.|:...:...:||:..:.|........|          |.:|:..|||.....|
  Fly    60 FFGCFGAIKESICVTWAYATSMLVMLIVSIVMLFVFRMH----------FEEDSITKLKQAFAKQ 114

Human   140 RETLKAI-----HYAVCRLGKDTLLRFLRIVSAHRVLTAPDQCKHSN 181
            ..|..|:     .|..|.:.|  |..:     ....:|.|..|...|
  Fly   115 TNTFDAMAEYQTQYQCCGIYK--LKDY-----GDAYITVPSSCYDQN 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD9XP_005253871.1 Tetraspannin 9..>147 CDD:278750 36/141 (26%)
tetraspanin_LEL 111..>149 CDD:243179 9/42 (21%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 44/177 (25%)
tetraspanin_LEL 93..174 CDD:239401 17/79 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.