DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNER and glp-1

DIOPT Version :9

Sequence 1:NP_620711.3 Gene:DNER / 92737 HGNCID:24456 Length:737 Species:Homo sapiens
Sequence 2:NP_499014.1 Gene:glp-1 / 176286 WormBaseID:WBGene00001609 Length:1295 Species:Caenorhabditis elegans


Alignment Length:419 Identity:127/419 - (30%)
Similarity:176/419 - (42%) Gaps:103/419 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   293 IVALRLTLVVKVSTCVPGESHANDLECSGKGKCTTKPSEATFSCTCEEQYVGTFCE-EYDACQRK 356
            ::.:.|.....:::.:.|.....:..||..|||.......|:.|.|::.:.|.||| |.|.    
 Worm     3 VLLILLAFFAPIASQLMGGECGREGACSVNGKCYNGKLIETYWCRCKKGFGGAFCERECDL---- 63

Human   357 PCQNNASCIDANEKQD--GSNFTCVCL-----------------PGYTGELCQ----SKIDYCIL 398
            .|:....||     .|  |.|.||:|.                 .||.|..|:    |.::.|..
 Worm    64 DCKRGEKCI-----YDVYGENPTCICQDCEDETPPTERTQKGCEEGYGGPDCKTPLFSGVNPCDS 123

Human   399 DPCRNGATCISSLSGFTCQCPEGYFGSACEEKVDPCASSPCQNNGTCYVDGVHFTCNCSPGFTGP 463
            |||.|| .|.....||.|.|..||.||.|||.:|.||.:.|....||.....::.|:|..|.:|.
 Worm   124 DPCNNG-LCYPFYGGFQCICNNGYGGSYCEEGIDHCAQNECAEGSTCVNSVYNYYCDCPIGKSGR 187

Human   464 TCAQLIDFCAL--SPCAHGTC---RSVGTSYKCLCDPGYHGLYCEEEYNECL-SAPCLNAATCRD 522
            .|.:  ..|||  :.|.||.|   |....:::|:||.||.|.:|.::.|||| ...|:|.:||.:
 Worm   188 YCER--TECALMGNICNHGRCIPNRDEDKNFRCVCDSGYEGEFCNKDKNECLIEETCVNNSTCFN 250

Human   523 LVNGYECVCLAEYKGTHCELYKDPCANVSCLN--------------------------------- 554
            |...:.|.|...|.|.:||...|.|.:..|.|                                 
 Worm   251 LHGDFTCTCKPGYAGKYCEEAIDMCKDYVCQNDGYCAHDSNQMPICYCEQGFTGQRCEIECPSGF 315

Human   555 -----------------GATCDSDG--LNGTCICAPGFTGEECDI--------DINECDSNPCHH 592
                             ..||.:||  :||.|:|.|.:.|:.|:|        ||..|..|||.:
 Worm   316 GGIHCDLPLQRPHCSRSNGTCYNDGRCINGFCVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCVN 380

Human   593 GGSCLDQPN-GYNCHCPHGWVGANCEIHL 620
            ..:|:|..| ||:||||.|:.|.|||.||
 Worm   381 NATCIDLKNSGYSCHCPLGFYGLNCEQHL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNERNP_620711.3 Interaction with NOTCH1. /evidence=ECO:0000250 44..133
EGF_CA 393..428 CDD:238011 15/34 (44%)
EGF_CA 431..465 CDD:238011 10/33 (30%)
EGF_CA 469..503 CDD:238011 14/38 (37%)
EGF_CA 507..541 CDD:238011 13/34 (38%)
EGF_CA 581..617 CDD:238011 18/36 (50%)
Interaction with AP1G1 and somatodendritic targeting. /evidence=ECO:0000250 677..680
glp-1NP_499014.1 EGF_CA 118..152 CDD:238011 15/34 (44%)
EGF_CA 155..190 CDD:238011 10/34 (29%)
EGF_CA 232..269 CDD:238011 13/36 (36%)
EGF_CA 369..406 CDD:238011 18/36 (50%)
EGF_CA 451..479 CDD:238011
NL 489..526 CDD:197463
Notch 533..568 CDD:278494
Notch 573..608 CDD:278494
NOD 612..661 CDD:284282
NODP 698..755 CDD:284987
ANK repeat 921..959 CDD:293786
ANK 926..1054 CDD:238125
Ank_5 949..1002 CDD:290568
ANK 956..1127 CDD:238125
ANK repeat 961..992 CDD:293786
ANK repeat 994..1028 CDD:293786
Ank_2 999..1105 CDD:289560
ANK repeat 1030..1061 CDD:293786
ANK repeat 1071..1105 CDD:293786
Ank_2 1079..1171 CDD:289560
ANK repeat 1107..1138 CDD:293786
ANK repeat 1140..1170 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D7525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.