DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYTH2 and SPBC211.03c

DIOPT Version :9

Sequence 1:XP_006723535.1 Gene:CYTH2 / 9266 HGNCID:9502 Length:421 Species:Homo sapiens
Sequence 2:NP_596613.1 Gene:SPBC211.03c / 2540746 PomBaseID:SPBC211.03c Length:1462 Species:Schizosaccharomyces pombe


Alignment Length:292 Identity:85/292 - (29%)
Similarity:139/292 - (47%) Gaps:33/292 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    51 LLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRK----MAMGRKKFNMDPKKGIQFLVENELL 111
            ||..|....|.|....::......::.:|||..::|    :..|.:.||..|..||.||.::.::
pombe   512 LLNFIYYFHEHLQPCYNDPNNTFKDDVAKTLIESKKRKAIIIEGAELFNESPSDGIAFLTQHSII 576

Human   112 Q--NTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFR 174
            :  :.|..|..|.:....|:|..:|::|.:..  |..:|:||:...:|....:.:|||..|.|||
pombe   577 KQSDNPTCIVEFFHSTNRLSKRVLGEFLTKGS--NSHILNAFISAFDFKGKRIDEALRLLLQSFR 639

Human   175 LPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRD--KPGLERFVA 237
            ||||:|.|:|::|.|:..|...||....|.|..:|||:::|||||..||||::.  :..|:.|..
pombe   640 LPGESQLIERVLETFSHYYMSANPDSMSSKDAAFVLSYSIIMLNTDQHNPNIKSQRRMTLDDFCR 704

Human   238 MNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVK---TWK 299
            ..||:|:|.|.....|..:|.:|:.....:.|:...:|:..:.      | .||...||   .:|
pombe   705 NVRGVNDGQDFDRNFLSEIYKAIKENEIIVAEEHDTELSFLYI------W-SKLQQSVKITEPFK 762

Human   300 RR-------------WFILTDNCLYYFEYTTD 318
            |.             |..:....:|.|...|:
pombe   763 RSSSNVHDKIVFLEVWKSIMAALIYVFSTATE 794

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYTH2XP_006723535.1 Sec7 83..265 CDD:396096 64/189 (34%)
PH_GRP1-like 280..399 CDD:269954 11/55 (20%)
SPBC211.03cNP_596613.1 Sec7_N 287..475 CDD:289549
COG5307 289..1303 CDD:227623 85/292 (29%)
Sec7 548..732 CDD:279680 63/185 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10663
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.