DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STK17A and CG10177

DIOPT Version :9

Sequence 1:NP_004751.2 Gene:STK17A / 9263 HGNCID:11395 Length:414 Species:Homo sapiens
Sequence 2:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster


Alignment Length:259 Identity:74/259 - (28%)
Similarity:115/259 - (44%) Gaps:20/259 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    69 RGKFAVVR-KCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLELAQDNPWVINLHEVYETAS 132
            ||:....| ||         ..|.:.|:.:..| |.:...|..||...|.:|.:|.|....|...
  Fly   165 RGQTRANRTKC---------TVKMVNKQTQSND-RGDTYMEAEVLRQLQSHPNIIELMYTVEDER 219

Human   133 EMILVLEYAAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSE 197
            .|..|||:.   :...|.|..:.....|.|.:.:||..:..:..:|...|:|.|:||:|:|:.|.
  Fly   220 YMYTVLEHL---DCNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSS 281

Human   198 SPLGD---IKIVDFGLSRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYVMLTG 259
            |...:   :|:.:|.|:...:.| :|....|||.|:|||:::........|.||:||..:.||.|
  Fly   282 SGKWNFKMVKVANFDLATYYRGS-KLYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCG 345

Human   260 ISPFLG--NDKQETFLNISQMNLSYSEEEFDVLSESAVDFIRTLLVKKPEDRATAEECLKHPWL 321
            ..||..  .:.:|.:..|.....:|.::...|:|..|...|..|||..|..|....|..|..:|
  Fly   346 KMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAELDKFQFL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STK17ANP_004751.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
STKc_DRAK1 51..321 CDD:271099 73/257 (28%)
S_TKc 64..321 CDD:214567 73/257 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..363
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 73/257 (28%)
PKc_like 164..403 CDD:304357 71/251 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.