DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STK17A and CG10126

DIOPT Version :9

Sequence 1:NP_004751.2 Gene:STK17A / 9263 HGNCID:11395 Length:414 Species:Homo sapiens
Sequence 2:NP_788664.2 Gene:CG10126 / 41579 FlyBaseID:FBgn0038088 Length:227 Species:Drosophila melanogaster


Alignment Length:187 Identity:38/187 - (20%)
Similarity:63/187 - (33%) Gaps:51/187 - (27%)


- Green bases have known domain annotations that are detailed below.


Human   217 SEELREIMGTPEYVAPEILSYDPISM---------ATDMWSIGVLTYVMLTGISPFLGNDKQETF 272
            |:.|||:....:        .|||:.         ||.:..:|.....|....|..|  :::|..
  Fly    29 SQALRELTDGED--------KDPITKLRLLCLSRGATGILGLGRAFRAMDDDGSKAL--NEEEFI 83

Human   273 LNISQMNLSYSEEE-------FDVLSESAVDFIRTLLVKKP--------------------EDRA 310
            ..|....|..||||       ||.....:::....||..:|                    ||..
  Fly    84 TGIRDTGLDVSEEEIKQMFATFDEDGSGSINMTEFLLKLRPPMPQSRLNIIDQAFNKMDRDEDGV 148

Human   311 TAEECLKHPWLTQSSIQE-PSFRMEKALEEANALQEGHSVPEINSDTDKSETKESIV 366
            ...:.||:.:    |::| |.::..:..|:.......|:......:.|...|:|..|
  Fly   149 ITIQDLKNVY----SVKEHPKYQSGEKSEDEILTDFLHNFEGGRGNLDGKITREEFV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STK17ANP_004751.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
STKc_DRAK1 51..321 CDD:271099 29/139 (21%)
S_TKc 64..321 CDD:214567 29/139 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..363 3/20 (15%)
CG10126NP_788664.2 EF-hand_7 62..119 CDD:290234 13/58 (22%)
EFh 64..119 CDD:238008 12/56 (21%)
EFh 97..154 CDD:238008 8/56 (14%)
EF-hand_7 98..158 CDD:290234 9/59 (15%)
EF-hand_7 134..204 CDD:290234 13/72 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.