DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STK17B and CaMKI

DIOPT Version :9

Sequence 1:NP_004217.1 Gene:STK17B / 9262 HGNCID:11396 Length:372 Species:Homo sapiens
Sequence 2:NP_524622.1 Gene:CaMKI / 43792 FlyBaseID:FBgn0016126 Length:405 Species:Drosophila melanogaster


Alignment Length:367 Identity:111/367 - (30%)
Similarity:174/367 - (47%) Gaps:75/367 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    23 IKMENFNNFYILTSKELGRGKFAVVRQCISK-STGQEYAAKFL-KKRRRGQDCRAEILHEIAVLE 85
            :.:|...|.:.|    ||.|.|:.||...|| |.|:.:|.|.: ||..:|::...|  :||.||.
  Fly    25 VSIEEKYNLHGL----LGTGAFSEVRLAESKDSPGEHFAVKIIDKKALKGKEESLE--NEIRVLR 83

Human    86 LAKS------C--------PRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVS--END 134
            ...:      |        |.::.|.|.||:.|::.|::|...|||:|.    .:.|..|  |.|
  Fly    84 RFSANHFDGKCLNGTRLTHPNIVQLLETYEDKSKVYLVMELVTGGELFD----RIVEKGSYTEKD 144

Human   135 VIRLIKQILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIV--DFGMSRK-----IGHACEL 192
            ...||:||||.|.|:|:..:||.||||:|:|..|  |..|.||:  |||:|:.     :..||  
  Fly   145 ASHLIRQILEAVDYMHEQGVVHRDLKPENLLYYS--PDDDSKIMISDFGLSKMEDSGIMATAC-- 205

Human   193 REIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEE 257
                |||.|:|||:|...|...|.|:|:||:|:|:||....||..|::...:..|.:.:.::...
  Fly   206 ----GTPGYVAPEVLAQKPYGKAVDVWSIGVISYILLCGYPPFYDENDANLFAQILKGDFEFDSP 266

Human   258 TFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWL------------------------QQWD- 297
            .:..:|:.|..||::|:....|||.|.:..|.|:|:                        .:|. 
  Fly   267 YWDEISESAKHFIKNLMCVTVEKRYTCKQALGHAWISGNEASSRNIHGTVSEQLKKNFAKSRWKQ 331

Human   298 -------FENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNG 332
                   ...:......|:|:...|.|..|::|.|:.::..|
  Fly   332 AYYAATVIRQMQRMALNSNSNANFDSSNSSNQDSTTPTAATG 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STK17BNP_004217.1 STKc_DRAK2 24..293 CDD:271100 101/293 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..362 8/28 (29%)
CaMKINP_524622.1 STKc_CaMKI 27..301 CDD:270985 101/291 (35%)
S_TKc 31..302 CDD:214567 100/288 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.