DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STK17B and CG10177

DIOPT Version :9

Sequence 1:NP_004217.1 Gene:STK17B / 9262 HGNCID:11396 Length:372 Species:Homo sapiens
Sequence 2:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster


Alignment Length:270 Identity:64/270 - (23%)
Similarity:124/270 - (45%) Gaps:29/270 - (10%)


- Green bases have known domain annotations that are detailed below.


Human    32 YILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLELAKSCPRVINL 96
            ||.|.:.:......::.:..:::...:...|.:.|:.:..| |.:...|..||...:|.|.:|.|
  Fly   148 YIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNKQTQSND-RGDTYMEAEVLRQLQSHPNIIEL 211

Human    97 HEVYENTSEIILILEYAAGGEIFSLC----LPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHL 157
            ....|:...:..:||:..       |    :.:...::||.|...:::..:..:.::||..::|.
  Fly   212 MYTVEDERYMYTVLEHLD-------CNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHR 269

Human   158 DLKPQNILL---SSIYPLGDIKIVDFGMS-----RKIGHACELREIMGTPEYLAPEILNYDPITT 214
            |:||:|:|:   |..:....:|:.:|.::     .|:...|      |||.|:|||::.......
  Fly   270 DIKPENLLVCSSSGKWNFKMVKVANFDLATYYRGSKLYVRC------GTPCYMAPEMIAMSGYDY 328

Human   215 ATDMWNIGIIAYMLLTHTSPFVG--EDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKN 277
            ..|.|::|:..:.:|....||..  ::::|.|..|......|.::..|.:|..||..|..|||.:
  Fly   329 QVDSWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSD 393

Human   278 PEKR-PTAEI 286
            |..| |.||:
  Fly   394 PSYRVPIAEL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STK17BNP_004217.1 STKc_DRAK2 24..293 CDD:271100 64/270 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..362
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 61/254 (24%)
PKc_like 164..403 CDD:304357 60/252 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.