DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STK17B and cmk1

DIOPT Version :9

Sequence 1:NP_004217.1 Gene:STK17B / 9262 HGNCID:11396 Length:372 Species:Homo sapiens
Sequence 2:NP_593464.1 Gene:cmk1 / 2542442 PomBaseID:SPACUNK12.02c Length:335 Species:Schizosaccharomyces pombe


Alignment Length:267 Identity:94/267 - (35%)
Similarity:137/267 - (51%) Gaps:20/267 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    39 LGRGKFAVVRQCISKSTGQEYAAKFLKKR--RRGQDCRAEILHEIAVLE-LAKSCPRVINLHEVY 100
            ||.|.:|.||:.:...|.:.||||.:.|:  .:.||.   :.:|||:|: ::...|.:::|.:.:
pombe    37 LGGGTYATVREAVHIETNKMYAAKIMNKKMMEKKQDF---VKNEIAILKRVSYEHPNILHLVDFF 98

Human   101 ENTSEIILILEYAAGGEIFS-LCLPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQNI 164
            |..:.:.||.|.|.|||:|. :|   ......|.|...|::.....|.|||.|.|||.||||:|:
pombe    99 ETVNNLYLITELATGGELFDRIC---AKGSFYEADAAALMRTTTSAVKYLHDNGIVHRDLKPENL 160

Human   165 LLSSIYPLGDIKIVDFGMSRKIGHACE------LREIMGTPEYLAPEILNYDPITTATDMWNIGI 223
            |..|..|..|:.|.|||:|    |..|      |....|||||:|||:..........|||.||:
pombe   161 LYRSKDPNSDLLIADFGLS----HFYEDSQYYMLMTACGTPEYMAPEVFRRTGYGKPVDMWAIGV 221

Human   224 IAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICL 288
            |.|.||:..:||......|....|......:::..:|.:|:.|.|||:..|..:|.||.||...|
pombe   222 ITYFLLSGYTPFARPSQVEVIEAILANEYTFNDPCWSGISETAKDFIKKCLENDPSKRLTAADAL 286

Human   289 SHSWLQQ 295
            .|.:|.:
pombe   287 KHPFLSE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STK17BNP_004217.1 STKc_DRAK2 24..293 CDD:271100 93/263 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..362
cmk1NP_593464.1 STKc_CAMK 30..290 CDD:270687 93/262 (35%)
S_TKc 31..291 CDD:214567 93/263 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.