DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STK17B and cmk-1

DIOPT Version :9

Sequence 1:NP_004217.1 Gene:STK17B / 9262 HGNCID:11396 Length:372 Species:Homo sapiens
Sequence 2:NP_500139.1 Gene:cmk-1 / 176989 WormBaseID:WBGene00000553 Length:348 Species:Caenorhabditis elegans


Alignment Length:314 Identity:99/314 - (31%)
Similarity:153/314 - (48%) Gaps:38/314 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    39 LGRGKFAVVRQCISKS-TGQEYAAKFL-KKRRRGQDCRAEILHEIAVLELAKSCPRVINLHEVYE 101
            ||.|.|:.|....||| .||.||.|.: ||..:|::...|  :||.||...:. ..::.|.:.|:
 Worm    28 LGTGAFSKVFLAESKSDAGQMYAVKCIDKKALKGKEESLE--NEIKVLRKLRH-NNIVQLFDTYD 89

Human   102 NTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQNILL 166
            ....:.|::|...|||:|...:.:  ...:|.|...||:|:||.|.::|.|.:||.||||:|:|.
 Worm    90 EKQFVYLVMELVTGGELFDRIVAK--GSYTEQDASNLIRQVLEAVGFMHDNGVVHRDLKPENLLY 152

Human   167 SSIYPLGDIKIVDFGMSRK-----IGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAY 226
            .:......|.|.|||:|:.     :..||      |||.|:|||:|...|...|.|:|:||:|||
 Worm   153 YNQDEDSKIMISDFGLSKTEDSGVMATAC------GTPGYVAPEVLQQKPYGKAVDVWSIGVIAY 211

Human   227 MLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHS 291
            :||....||..|.:...:..|.:...::....:..:|..|.|||..|:..:||.|.|.:..|||.
 Worm   212 ILLCGYPPFYDESDANLFAQIIKGEYEFDAPYWDQISDSAKDFITHLMCCDPEARFTCQDALSHP 276

Human   292 WLQQWDFENLFHPEETSSSSQTQD-------HSVRSSEDKTSKSSCNGTCGDRE 338
            |:             :.:::.|.|       |..:|...:..|.:.|.....|:
 Worm   277 WI
-------------SGNTAYTHDIHGTVAVHLKKSLAKRNWKKAYNAAAAIRQ 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STK17BNP_004217.1 STKc_DRAK2 24..293 CDD:271100 91/260 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..362 7/41 (17%)
cmk-1NP_500139.1 STKc_CaMKI 18..277 CDD:270985 91/259 (35%)
S_TKc 22..278 CDD:214567 91/260 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.