DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDLIM7 and ey

DIOPT Version :9

Sequence 1:NP_005442.2 Gene:PDLIM7 / 9260 HGNCID:22958 Length:457 Species:Homo sapiens
Sequence 2:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster


Alignment Length:287 Identity:65/287 - (22%)
Similarity:97/287 - (33%) Gaps:77/287 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    41 QAGVAVGDWVLSIDGENAGSLTHIEAQNKIRACGERLSLGLSRAQPVQSKPQKAS-------APA 98
            |..|...|.:.|:...|. .|.::.||.:.::.|.    |.|......|...|.|       :..
  Fly   201 QENVCTNDNIPSVSSINR-VLR
NLAAQKEQQSTGS----GSSSTSAGNSISAKVSVSIGGNVSNV 260

Human    99 ADPPRYTFAPSVSLNKTARPFGAPPPADSAPQQNGQPLRPLVPDASKQRLMENT---------ED 154
            |...|.|.:.|..|.:||.|..:.....::....|.....:.   .|.||: ||         |.
  Fly   261 ASGSRGTLSSSTDLMQTATPLNSSESGGASNSGEGSEQEAIY---EKLRLL-NTQHAAGPGPLEP 321

Human   155 WRPRPGTGQSRSFRILAHLTGTEFMQDPD---------EEHLKKS---------------SQVPR 195
            .|..|..|||.:     || ||. ...|.         ::|.::|               |::|.
  Fly   322 ARAAPLVGQSPN-----HL-GTR-SSHPQLVHGNHQALQQHQQQSWPPRHYSGSWYPTSLSEIPI 379

Human   196 TEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFA---ERYAPDKTSTV-----LTRHSQPATP 252
            :.||..||.|...  .||:.....| ||..::...:   :|..|..|..:     |..|....|.
  Fly   380 SSAPNIASVTAYA--SGPSLAHSLS-PPNDIESLASIGHQRNCPVATEDIHLKKELDGHQSDETG 441

Human   253 TPLQSRTSIVQAAAGGVPGGGSNNGKT 279
            :.....::          ||.||.|.|
  Fly   442 SGEGENSN----------GGASNIGNT 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDLIM7NP_005442.2 PDZ_signaling 5..79 CDD:238492 9/37 (24%)
Atrophin-1 <81..254 CDD:331285 49/220 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..142 13/66 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..226 16/73 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..258 4/23 (17%)
LIM1_Enigma 282..333 CDD:188836
LIM2_Enigma 341..392 CDD:188840
LIM3_Enigma 400..454 CDD:188842
eyNP_001014693.1 PAX 98..221 CDD:128645 5/20 (25%)
Homeobox 475..527 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.