DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPR50 and mtnr1ba

DIOPT Version :9

Sequence 1:NP_004215.2 Gene:GPR50 / 9248 HGNCID:4506 Length:617 Species:Homo sapiens
Sequence 2:NP_571470.1 Gene:mtnr1ba / 30669 ZFINID:ZDB-GENE-990415-157 Length:355 Species:Danio rerio


Alignment Length:297 Identity:147/297 - (49%)
Similarity:217/297 - (73%) Gaps:3/297 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    25 PALIIFMFCAMVI-TIVVDLIGNSMVILAVTKNKKLRNSGNIFVVSLSVADMLVAIYPYPLMLHA 88
            ||.::.:...::| |.|||::||.:||::|.:|:||||:||.|||||:.||:||..|||||:|||
Zfish    28 PAWVVMVLAGVLIFTSVVDVLGNVLVIISVLRNRKLRNAGNAFVVSLAFADLLVVCYPYPLVLHA 92

Human    89 MSIGGWDLSQLQCQMVGFITGLSVVGSIFNIVAIAINRYCYICHSLQYERIFSVRNTCIYLVITW 153
            |...||...:::|::.||:.|.||:||||||.||||||||:||.:..||:|:....|.:.|.:.|
Zfish    93 MLHAGWLPGEMECKVSGFLMGASVIGSIFNITAIAINRYCFICQANTYEKIYGRAGTLVLLTLVW 157

Human   154 IMTVLAVLPNMYIGTIEYDPRTYTCIFNYLNNPVFTVTIVCIHFVLPLLIVGFCYVRIWTKVLAA 218
            ::|.:|:|||:.:|::.||||.|:|.|:...:..:|:.:|.:||:||:.:|.|||:|||..||..
Zfish   158 VLTAIAILPNLSLGSLTYDPRVYSCTFSQTTSAGYTIAVVTVHFLLPIAVVTFCYLRIWVLVLRV 222

Human   219 RD--PAGQNPDNQLAEVRNFLTMFVIFLLFAVCWCPINVLTVLVAVSPKEMAGKIPNWLYLAAYF 281
            |.  .....|..:.:|:|:||||||:|:||||||.|:|::.:.|||.|..:...:|:||::.:||
Zfish   223 RRRVTTDVRPRLRPSELRHFLTMFVVFVLFAVCWAPLNLIGLAVAVDPPRVGPLVPDWLFVMSYF 287

Human   282 IAYFNSCLNAVIYGLLNENFRREYWTIFHAMRHPIIF 318
            :||||||||||:|||||:||||||..|..::..|.:|
Zfish   288 MAYFNSCLNAVVYGLLNQNFRREYRRILLSLCKPRLF 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPR50NP_004215.2 7tm_4 39..>198 CDD:304433 79/158 (50%)
7tm_1 45..294 CDD:278431 126/250 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..438
DUF4045 <364..600 CDD:289995
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 464..596
mtnr1baNP_571470.1 7tm_4 40..>145 CDD:304433 62/104 (60%)
7tm_1 49..300 CDD:278431 126/250 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D387687at33208
OrthoFinder 1 1.000 - - FOG0001264
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.