DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UBE2L6 and CG17030

DIOPT Version :9

Sequence 1:NP_004214.1 Gene:UBE2L6 / 9246 HGNCID:12490 Length:153 Species:Homo sapiens
Sequence 2:NP_647941.1 Gene:CG17030 / 38591 FlyBaseID:FBgn0035584 Length:180 Species:Drosophila melanogaster


Alignment Length:143 Identity:54/143 - (37%)
Similarity:79/143 - (55%) Gaps:3/143 - (2%)


- Green bases have known domain annotations that are detailed below.


Human    11 LEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIY 75
            |||.|..   ..|||..:..|:..|..||:|..|||...|:.:.|.||.:||||||.|...|::|
  Fly    23 LEDKQNL---QFRNLLVEPNNIYKWTGLLMPVAPPYDKGAYKMEIDFPLDYPFKPPRIHINTRMY 84

Human    76 HPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNA 140
            |.||:|.||:|:||:..|:|.|.|:..|||:.|...:|.|.......:::|.....:|..|.|.|
  Fly    85 HLNVNERGQVCVPILEVEHWIPTTRIDQVLQVLLATINDPQPENAWHIEMAGEYRNDPVRFFKMA 149

Human   141 EEFTLRFGVDRPS 153
            :.:..::...||:
  Fly   150 DAWVQKYSEPRPT 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UBE2L6NP_004214.1 UQ_con 6..144 CDD:306648 52/132 (39%)
CG17030NP_647941.1 COG5078 12..158 CDD:227410 52/137 (38%)
UQ_con 14..153 CDD:278603 52/132 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143142
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1420213at2759
OrthoFinder 1 1.000 - - FOG0002530
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.