DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHMP4C and CG5498

DIOPT Version :10

Sequence 1:NP_689497.1 Gene:CHMP4C / 92421 HGNCID:30599 Length:233 Species:Homo sapiens
Sequence 2:NP_730525.2 Gene:CG5498 / 40250 FlyBaseID:FBgn0027565 Length:448 Species:Drosophila melanogaster


Alignment Length:207 Identity:46/207 - (22%)
Similarity:84/207 - (40%) Gaps:15/207 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    24 EALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALKRKKR-FEKQLTQIDGTLS 87
            :|:..|:.|:..|.|:.|.||..|:......:::..:|||...:...||:. .||...:....|.
  Fly   244 QAVHNLQNTQAQLLKQLEDLEEEIKVNDDKVRQYMKENKRQMAKTYLRKRHLLEKNHERRSLALH 308

Human    88 TIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDL--NKIDDLMQEITEQQDIAQEISEAFS 150
            .||....:::.:..:..||......:..:|.|..|..|  :.:|:::.::.:..|..:|:.:..|
  Fly   309 NIESLLSSVDEAQNSGVVLDAYKIGSNTLKKVLSNSGLKYDNVDEVLADVRDTLDQHREVQDIMS 373

Human   151 QRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASS 215
            ..|......::|:|..||.||..|            :.|::..|...|..............|..
  Fly   374 NSVVENASQEDDQLEQELRELAGE------------SAPATFSPHINNNLRAEVVITDEEMIAML 426

Human   216 QRAEEEDDDIKQ 227
            |..|.||..:.|
  Fly   427 QDLEVEDGTVSQ 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHMP4CNP_689497.1 Intramolecular interaction with C-terminus. /evidence=ECO:0000250 1..153 29/131 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 46/207 (22%)
Snf7 24..190 CDD:460896 37/168 (22%)
Intramolecular interaction with N-terminus. /evidence=ECO:0000250 154..233 16/74 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..233 10/55 (18%)
CG5498NP_730525.2 Snf7 244..397 CDD:460896 36/152 (24%)

Return to query results.
Submit another query.