DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSC and HLH4C

DIOPT Version :9

Sequence 1:NP_005089.2 Gene:MSC / 9242 HGNCID:7321 Length:206 Species:Homo sapiens
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:56 Identity:25/56 - (44%)
Similarity:37/56 - (66%) Gaps:0/56 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   109 RNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQ 164
            |.|...|||.|:...:.:|:.|:..||.:|||.||||::.|:||..|||:|..:|:
  Fly   110 RTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVLE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSCNP_005089.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115 2/5 (40%)
Nuclear localization signal. /evidence=ECO:0000255 71..76
bHLH_TS_musculin 105..170 CDD:381546 25/56 (45%)
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 24/54 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.