DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RBM18 and CG14414

DIOPT Version :10

Sequence 1:NP_149108.1 Gene:RBM18 / 92400 HGNCID:28413 Length:190 Species:Homo sapiens
Sequence 2:NP_001285240.1 Gene:CG14414 / 32394 FlyBaseID:FBgn0030571 Length:213 Species:Drosophila melanogaster


Alignment Length:188 Identity:64/188 - (34%)
Similarity:92/188 - (48%) Gaps:29/188 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    19 GSLQEGHRLWIGNLDPKITE--------YHLLKLLQKFGKVKQFDFLFHKSGALEGQPRGYCFVN 75
            |:.:|..|:|:||||.:||:        :.||||:||.|.:::||.||||.|.:.||.|||.||.
  Fly    21 GNPEEARRIWVGNLDSRITDSICIAPYRFQLLKLMQKCGAIEKFDMLFHKGGPMVGQSRGYAFVT 85

Human    76 FETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKILPISLEPSSSTEPTQSNLSVT 140
            |...:.|..|:..|:|....::.:.||.|    |...:::..|..|....|:..|...:..:|.|
  Fly    86 FAQNEGATNALLKLDGTSVGNRSIAVRLA----KNIKYDETQKPKPRLDIPALGTGKREEKVSKT 146

Human   141 AKIKAIEAKLKMMAENPD------------AEYPAAPVYSYFKPPD-----KKRTTPY 181
            ..|:||||||||:....|            |..|....|.:.|..|     .|.:.||
  Fly   147 EAIRAIEAKLKMLERQTDDNLELNTAGRGEANVPFIQRYQFNKDRDGSQRYGKSSAPY 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RBM18NP_149108.1 hnRNP-R-Q <26..>189 CDD:273732 62/181 (34%)
RRM_RBM18 26..105 CDD:409791 36/86 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..190 6/21 (29%)
CG14414NP_001285240.1 RRM_RBM18 28..115 CDD:409791 37/90 (41%)

Return to query results.
Submit another query.