DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAPN13 and Pef

DIOPT Version :10

Sequence 1:NP_653176.2 Gene:CAPN13 / 92291 HGNCID:16663 Length:669 Species:Homo sapiens
Sequence 2:NP_610592.1 Gene:Pef / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster


Alignment Length:166 Identity:37/166 - (22%)
Similarity:69/166 - (41%) Gaps:12/166 - (7%)


- Green bases have known domain annotations that are detailed below.


Human   496 PSEHGSQQSIFNRYAQQRLDIDATQLQGLLN----QELLTGPPGDMFSLDECRSLVALMELKVNG 556
            |.....|.:..:..|||...:......|.:|    |..|....||.||.:.|:.::::.:...:|
  Fly    21 PGAFPPQNAQVSPQAQQWFSMVDRDRSGKINASELQAALVNGRGDHFSDNACKLMISMFDNDASG 85

Human   557 RLDQEEFARLWKRLVHYQHVFQKV-QTSPGVLLSSDLWKAIENTDFLRGIFISRELLHLVTLRYS 620
            .:|..||.:|:..:..:..||:.. |.|.|.:...:|.:|...    .|...|.|.::.: ::.|
  Fly    86 TIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQ----MGFRFSPEFINFL-VKKS 145

Human   621 DSVG--RVSFPSLVCFLMRLEAMAKTFRNLSKDGKG 654
            |..|  .||....:...::::...:.||.......|
  Fly   146 DPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAPN13NP_653176.2 Peptidase_C2 35..331 CDD:459889
Calpain_III 347..474 CDD:469636
EFh_PEF_CAPN13_14 501..669 CDD:320070 36/161 (22%)
EF-hand motif 501..529 CDD:320070 7/31 (23%)
EF-hand motif 542..571 CDD:320070 6/28 (21%)
EF-hand motif 572..605 CDD:320070 7/33 (21%)
EF-hand motif 611..639 CDD:320070 5/29 (17%)
EF-hand motif 641..669 CDD:320070 3/14 (21%)
PefNP_610592.1 EFh_PEF_peflin 34..198 CDD:320059 35/153 (23%)
EF-hand motif 34..63 CDD:320059 7/28 (25%)
EF-hand motif 71..100 CDD:320059 6/28 (21%)
EF-hand motif 101..131 CDD:320059 7/33 (21%)
EF-hand motif 137..166 CDD:320059 5/29 (17%)
EF-hand motif 167..198 CDD:320059 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.