DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGI1 and HUL4

DIOPT Version :9

Sequence 1:NP_001028229.1 Gene:MAGI1 / 9223 HGNCID:946 Length:1462 Species:Homo sapiens
Sequence 2:NP_012570.3 Gene:HUL4 / 853494 SGDID:S000003797 Length:892 Species:Saccharomyces cerevisiae


Alignment Length:183 Identity:41/183 - (22%)
Similarity:68/183 - (37%) Gaps:43/183 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   222 TKSYNDMQNAGIVHAENEEED----DVPEMNSSFTADSGEQEEHTLQ-----ETALPPVNSSIIA 277
            |||..:..|...::.:.....    |.|    :|....|:..:..|.     ...|...||:|: 
Yeast   573 TKSLFNPMNGLFIYIKESSRSWFAIDPP----NFDKSKGKNSQLELYYLFGVVMGLAIFNSTIL- 632

Human   278 APITDPSQKFPQYL-------PLSAEDNLGPLPENWE-----MAYTENG--EVYFIDHNT--KTT 326
                  ..:||:.|       |||.||.....||...     :.|||:.  :|:.:...|  :..
Yeast   633 ------DLQFPKALYKKLCSEPLSFEDYSELFPETSRNLIKMLNYTEDNFEDVFSLTFETTYRNN 691

Human   327 SW-LDPRCLNKQQKPLEECEDDEGVHTEELDSELELPAGW-----EKIEDPVY 373
            :| |:....:|:...:|.||:...|...: .::.|....|     ||..:|.|
Yeast   692 NWILNDSKSSKEYVTVELCENGRNVPITQ-SNKHEFVMKWVEFYLEKSIEPQY 743

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGI1NP_001028229.1 PDZ_signaling 15..100 CDD:238492
GuKc 122..293 CDD:214504 16/86 (19%)
WW 303..332 CDD:238122 9/38 (24%)
WW 361..390 CDD:278809 5/18 (28%)
PDZ 469..555 CDD:214570
PDZ 640..723 CDD:214570
MAGI_u5 722..805 CDD:293271
PDZ_signaling 819..894 CDD:238492
PDZ_signaling 968..1062 CDD:238492
PDZ 1123..1205 CDD:214570
HUL4NP_012570.3 HUL4 1..892 CDD:227354 41/183 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.