DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCLK1 and lok

DIOPT Version :9

Sequence 1:NP_001317000.1 Gene:DCLK1 / 9201 HGNCID:2700 Length:740 Species:Homo sapiens
Sequence 2:NP_477219.1 Gene:lok / 35288 FlyBaseID:FBgn0019686 Length:476 Species:Drosophila melanogaster


Alignment Length:286 Identity:106/286 - (37%)
Similarity:158/286 - (55%) Gaps:18/286 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   378 EGFQIPATITERYKVGRTIGDGNFAVVKECVERSTAREYALKIIKKSKCRGKE--------HMIQ 434
            |...:|..|.:.|.|.|.:|.|.:.:|:...:..|.:::|:||:||:...|..        ..:.
  Fly   162 ESIGLPEEINKTYYVNRKLGSGAYGLVRLVYDTRTCQQFAMKIVKKNMLSGARPSTNFSDPDRVL 226

Human   435 NEVSILRRVKHPNIVLLIEEMDVPTELYLVMELVKGGDLFDAITSTNKYTERDASGM-LYNLASA 498
            ||..|::.:.||.:|.:.:.:|.|..:|:|:|.::||||.:.|.| ||....|.|.: .|.:..|
  Fly   227 NEAKIMKNLSHPCVVRMHDIVDKPDSVYMVLEFMRGGDLLNRIIS-NKLLSEDISKLYFYQMCHA 290

Human   499 IKYLHSLNIVHRDIKPENLLVYEHQDGSKSLKLGDFGLATIV--DGPLYTVCGTPTYVAPEIIAE 561
            :||||...|.|||:||:|:|: |..|....||:.||||:..|  |..:.|:||||.|||||::..
  Fly   291 VKYLHDRGITHRDLKPDNVLL-ETNDEETLLKVSDFGLSKFVQKDSVMRTLCGTPLYVAPEVLIT 354

Human   562 TG---YGLKVDIWAAGVITYILLCGFPPFRGSGDDQEVLFDQILMGQVDFPSPYWDNVSDSAKEL 623
            .|   |..|||||:.||:.:..|.|..||  |.:.......||..|:..:..|.|.:||..||.|
  Fly   355 GGREAYTKKVDIWSLGVVLFTCLSGTLPF--SDEYGTPAAQQIKKGRFAYGHPSWKSVSQRAKLL 417

Human   624 ITMMLLVDVDQRFSAVQVLEHPWVND 649
            |..||:||.::|.|...||:..|:.|
  Fly   418 INQMLIVDPERRPSIDDVLQSSWLRD 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCLK1NP_001317000.1 DCX1_DCLK1 55..143 CDD:340660
DCX2 182..265 CDD:340589
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..378 106/286 (37%)
STKc_DCKL1 383..650 CDD:271085 105/281 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 697..740
lokNP_477219.1 FHA 39..156 CDD:238017
STKc_Chk2 167..441 CDD:270986 103/277 (37%)
S_TKc 174..441 CDD:214567 101/270 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.