DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CD4 and CG7166

DIOPT Version :10

Sequence 1:NP_000607.1 Gene:CD4 / 920 HGNCID:1678 Length:458 Species:Homo sapiens
Sequence 2:NP_649339.2 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:443 Identity:100/443 - (22%)
Similarity:164/443 - (37%) Gaps:97/443 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    27 KVVLGKKGDTVELTCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRSLWDQGN 91
            ||::   |:|:||.|......|....|:..:         |.||.|..|:.  .|.|..:  .|:
  Fly    49 KVIV---GETIELPCKVQNLGSFVLLWRKGS---------SVLTAGHLKIT--RDQRFKI--VGD 97

Human    92 FPLIIKNLKIEDSDTYICEVEDQKEE-----VQLLV----FGLTANSDTHLLQGQSLTLTLESPP 147
            :.|.|..:|.:|:..|||::.||:..     |::||    ..|..|......:|.::||..::..
  Fly    98 YNLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALPHNGQVTARKGSTVTLECKASG 162

Human   148 GSSPSV------QCRSPRGKNIQGGKTLSVSQLELQDSGTWTCTVLQNQK-KVEFKIDIVVLA-- 203
            ...|::      ....|  .::....||.:..::...:||:.|:.....| :|...|.:.:|:  
  Fly   163 NPVPTIFWFKKDVFSGP--THLSDSSTLILENVDRHHAGTYQCSADNGVKDRVSMDIQLTILSPP 225

Human   204 -FQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWWQ-------AERAS-----SSKSWITFD 255
             .....|.|:..||..||    |...|.....|..||:|       .:|.|     ...|.|..:
  Fly   226 EITVEKSWVHASEGYDVE----LVCIVHGDVNSEMLWYQNSFLLDATDRRSMYPRDDRYSLIIRN 286

Human   256 LKNKEVSVKRVTQDPKLQMGKKL--------PLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEV 312
            .:..:........|..|...||.        |.....| ||..:....|||..:|:....  .|:
  Fly   287 FQPTDFGNYSCVADNALGRTKKYIEVSGRPGPADFISP-ALSGFLDHYNLTWTIESIPPL--DEI 348

Human   313 NLVVMRATQLQKNLTCEVWG--------PT-----SPKLMLSLKLEN------KEAKVSKREKAV 358
            .|:..|   |..|.|.:..|        ||     ....::|..::|      .||.|..:.|..
  Fly   349 KLLYRR---LLMNETYQHPGKWHEYHIKPTPIRTDGSHFLMSYLVKNLEHNAVYEAIVQAKNKYG 410

Human   359 WVLNPEAGMWQCLLSDSGQVL---------LESNIKVLPTWSTPVQPMALIVL 402
            |  |..:.:.|....:...:|         :.|||::.||.|..:....::||
  Fly   411 W--NEISDIHQFYTRNHDLLLDIDMEYKMGISSNIRISPTVSGIILSAFILVL 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CD4NP_000607.1 IgV_1_CD4 26..122 CDD:409487 27/99 (27%)
FR1 26..42 CDD:409487 6/14 (43%)
Ig strand A 26..32 CDD:409487 2/4 (50%)
Ig strand B 35..42 CDD:409487 3/6 (50%)
CDR1 43..50 CDD:409487 1/6 (17%)
Ig strand C 50..55 CDD:409487 1/4 (25%)
FR2 51..56 CDD:409487 1/4 (25%)
CDR2 58..72 CDD:409487 3/13 (23%)
Ig strand C' 58..64 CDD:409487 0/5 (0%)
Ig strand C' 68..72 CDD:409487 2/3 (67%)
FR3 73..110 CDD:409487 10/36 (28%)
Ig strand D 79..83 CDD:409487 1/3 (33%)
Ig strand E 90..99 CDD:409487 3/8 (38%)
Ig strand F 104..111 CDD:409487 3/6 (50%)
CDR3 111..114 CDD:409487 0/2 (0%)
Ig strand G 114..122 CDD:409487 2/12 (17%)
FR4 115..122 CDD:409487 1/11 (9%)
IgC2_2_CD4 123..204 CDD:409491 16/90 (18%)
Ig strand A 123..128 CDD:409491 1/4 (25%)
Ig strand B 137..145 CDD:409491 2/7 (29%)
Ig strand C 152..157 CDD:409491 0/10 (0%)
Ig strand C' 162..166 CDD:409491 0/3 (0%)
Ig strand E 167..173 CDD:409491 2/5 (40%)
Ig strand F 181..187 CDD:409491 2/5 (40%)
Ig strand G 192..200 CDD:409491 2/7 (29%)
CD4-extracel 207..316 CDD:462712 30/128 (23%)
C2-set 317..389 CDD:399065 20/99 (20%)
CD4_CD 401..444 CDD:439337 2/2 (100%)
HIV-1 Vpu-susceptibility domain 427..455
CG7166NP_649339.2 IG_like 50..133 CDD:214653 26/98 (27%)
Ig strand B 56..60 CDD:409353 2/3 (67%)
Ig strand C 69..73 CDD:409353 0/3 (0%)
Ig strand E 98..102 CDD:409353 1/3 (33%)
Ig strand F 112..116 CDD:409353 2/3 (67%)
Ig_3 134..207 CDD:464046 12/74 (16%)
Ig_3 224..301 CDD:464046 16/80 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.