DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNAB3 and CG18547

DIOPT Version :9

Sequence 1:XP_011522370.1 Gene:KCNAB3 / 9196 HGNCID:6230 Length:411 Species:Homo sapiens
Sequence 2:NP_650138.1 Gene:CG18547 / 41452 FlyBaseID:FBgn0037973 Length:345 Species:Drosophila melanogaster


Alignment Length:255 Identity:66/255 - (25%)
Similarity:111/255 - (43%) Gaps:34/255 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     6 QPTPSAFLSGPLRLLEMAAKTPSNFTKNLGKSGLRVSCLGLG---TWVTFGSQISDETAEDVLTV 67
            |..|:.::.|    ....||......:||||:||:||.:..|   ....:|..:.    |.:.||
  Fly     3 QTLPATYVKG----FHDEAKVRRMEYRNLGKTGLQVSKVSFGGGALCANYGFDLE----EGIKTV 59

Human    68 --AYEHGVNLFDTAEVYAAGKAERTLGNILKSKGWRRSSYVITTKIFWGGQAETER----GLSRK 126
              |.:.|:|..|||..|..|::|..||..||..  .|.||.|.||:   .:.|.:.    ..|.|
  Fly    60 HEAVKSGINYIDTAPWYGQGRSEEVLGLALKDV--PRESYYIATKV---ARYELDYDKMFDFSAK 119

Human   127 HIIEGLRGSLERLQLGYVDIV------FANRSDPNCPMEEIVRAMTYVINQGLALYWGTSRWGAA 185
            ...|.:..||:.|.|.|||::      ||  .|.:..:.|.:..:..::.:|.|.:.|.|.:..:
  Fly   120 KTRESVEKSLKLLGLDYVDVIQIHDIEFA--KDLDIVINETLPTLEQLVKEGKARFIGVSAYPIS 182

Human   186 EIMEAYSMARQFNLIPPVCEQAEHHLFQREKVEMQLPELYHKIGVGSVTWYPLACGLITS 245
            .:.|  .:.|....:..|...|.:.|  .::..::..:.:....:|.:.....|.||:|:
  Fly   183 VLKE--FLTRTAGRLDTVLTYARYTL--TDETLLEYLDFFKSQNLGVICAAAHALGLLTN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNAB3XP_011522370.1 Aldo_ket_red 31..300 CDD:119408 61/230 (27%)
CG18547NP_650138.1 Tas 22..331 CDD:223739 61/232 (26%)
Aldo_ket_red 24..321 CDD:294321 61/230 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0667
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5328
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R634
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.