DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC16A7 and CG8389

DIOPT Version :9

Sequence 1:XP_011537291.1 Gene:SLC16A7 / 9194 HGNCID:10928 Length:504 Species:Homo sapiens
Sequence 2:NP_611076.2 Gene:CG8389 / 36764 FlyBaseID:FBgn0034063 Length:471 Species:Drosophila melanogaster


Alignment Length:513 Identity:114/513 - (22%)
Similarity:201/513 - (39%) Gaps:102/513 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    14 PDGGWGWIVVGA-AFISIGFSYAFPKAVTVFFKEIQQIFHTTYSEIAWISSIMLAVMYAGGRIFE 77
            ||||:|||||.| |.|::...........:|..|:|::...|::.....:...||:.:       
  Fly    10 PDGGYGWIVVAAVALINMTNQSILSVFGQLFVGELQKMQEDTFTAALITNLNSLALNF------- 67

Human    78 SFLIFTSLRIQCSFTQSGSCLGPVSSVLVNKYGSRPVVIAGGLLCCLGMVLASFSSSVVQLYLTM 142
                            ||..:||.    :..:..|.|...|.:|..||:.|.:|:|......|..
  Fly    68 ----------------SGLFIGPA----IKSFKPRNVAATGCILVALGLALCAFASESWHFILGY 112

Human   143 GFITGLGLAFNLQPALTIIGKYFYRKRPMANGLAMAGSPVFLSSLAPFNQYLFNTFGWKGSFLIL 207
            .|..|.||..........|..||..||..|.|:::||:.:....:....:||.:..|::.:.|.:
  Fly   113 SFFVGFGLGLISPSTFMAINSYFTTKRGRAVGVSLAGAGLGQVLIPHLVRYLLDNHGFRYAVLSM 177

Human   208 GSLLLNACVAGSLMRPLGPNQTTSKSKNK-----------------------TGKTEDDSSPKKI 249
            .||.|......:.::||.|   .:|..|:                       |.:::.:.||..:
  Fly   178 SSLSLFGLFGAAFLKPLNP---PAKHNNRKHIRLLTEADGEKTSPLQVVIVPTNQSKIERSPPNV 239

Human   250 KTKKSTW-EKVNKYLDFSLFKHRGFLIYLSGNVIMFLGFFAPI----IFLAPYAKDQGIDEYSAA 309
            .|..|.. :::.:.:|..|.|.   |::.|..|.|.|.:.|.|    ||.....:...::....|
  Fly   240 DTLCSRMGQRLVQAMDLELLKD---LVFWSIIVGMALVYTATINFTMIFPGFLGQTAQLNSQMVA 301

Human   310 FLLSVMAFVDMFARPSVGLIANSKYIRPRIQYFFSFAIMFNGVCHLLCPLAQDYTSLVLYAVFFG 374
            |.:|::|..|:..|..:.::.:    ..||.|...|.|...|:....|.||::.|..|:..:...
  Fly   302 FCMSLVAGADIVFRLLLPIVTD----HLRIPYRVVFLIGIVGLFVARCVLAENQTLPVIITMSVL 362

Human   375 LGFGSVSSVL-----------FETLMDLVGAPRFSSAVGLVTIVECGPVLLGPPLAGKLVDLTGE 428
            .|....::|:           .|.|...:|....|..|.::|:             |:|:....:
  Fly   363 TGMMKSATVINNNLTISAHCRSEKLAGGLGLSMMSKGVIVITV-------------GQLLGWVRD 414

Human   429 YKYMYMSC----GAI-VVAASVWLLIGNAINYRLLAKERKEENARQKTRESEPLSKSK 481
            |...|:.|    |.| :|...||       ...:|.:.|::..|..|:.|::.:..::
  Fly   415 YADSYLICLYAQGVILLVVVLVW-------TPEILYRHRRQRCATNKSMETQSIDAAE 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC16A7XP_011537291.1 2A0113 15..484 CDD:273325 113/512 (22%)
MFS 20..449 CDD:119392 104/473 (22%)
CG8389NP_611076.2 MFS 19..425 CDD:119392 96/455 (21%)
MFS_1 19..400 CDD:284993 89/417 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2504
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.