DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYLK3 and CMK1

DIOPT Version :9

Sequence 1:NP_872299.2 Gene:MYLK3 / 91807 HGNCID:29826 Length:819 Species:Homo sapiens
Sequence 2:NP_116669.1 Gene:CMK1 / 850568 SGDID:S000001910 Length:446 Species:Saccharomyces cerevisiae


Alignment Length:324 Identity:103/324 - (31%)
Similarity:159/324 - (49%) Gaps:36/324 - (11%)


- Green bases have known domain annotations that are detailed below.


Human   519 EVLGGGRFGQVHRCTEKSTGLPLAAKIIKVKSAKDR----EDVKNEINIMNQLSHVNLIQLYDAF 579
            :.||.|.||.|.:.....||..:|.||:..|:.|..    |.:.:|::|:.:|.|.|::...|.|
Yeast    41 KTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPNIVAFKDWF 105

Human   580 ESKHSCTLVMEYVDGGELFDRITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILC 644
            |||....::.:...||||||||. :|...||.|.|....:|...|.|:|...|:|.||||||:|.
Yeast   106 ESKDKFYIITQLAKGGELFDRIL-KKGKFTEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLLY 169

Human   645 VNQTGHQ-IKIIDFGLARRYKPREKLKVN-FGTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLS 707
            ::::... :.:.|||:|:|.|..|:|... .|:..::||||:..:....|.|:||:|||||.||.
Yeast   170 IDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLC 234

Human   708 GLSPFLGETDAETMNFIVNCSW-----DFDADTFEGLSEEAKDFVSRLLVKEKSCRMSATQCLKH 767
            |.|.|..|   ...:|:..|:.     .|....::.:|.:||.|:.:.|..:.|.|.:|.:.|:.
Yeast   235 GYSAFRAE---RVQDFLDECTTGEYPVKFHRPYWDSVSNKAKQFILKALNLDPSKRPTAAELLED 296

Human   768 EWL--------NNLPA-------------KASRSKTRLKSQLLLQKYIAQRKWKKHFYVVTAAN 810
            .|:        |.||.             ...|.:..:|.|.|...|:.|.:....|...:.||
Yeast   297 PWIICTELKTHNLLPGLKEGLDARQKFRNSVERVRLNMKIQKLRDLYLEQTESDSDFDEGSQAN 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYLK3NP_872299.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..334
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..462
STKc_MLCK3 510..770 CDD:271094 90/261 (34%)
S_TKc 513..770 CDD:214567 90/261 (34%)
CMK1NP_116669.1 STKc_CAMK 36..298 CDD:270687 90/260 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24347
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.