DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYLK3 and sqa

DIOPT Version :9

Sequence 1:NP_872299.2 Gene:MYLK3 / 91807 HGNCID:29826 Length:819 Species:Homo sapiens
Sequence 2:NP_001260832.1 Gene:sqa / 36002 FlyBaseID:FBgn0259678 Length:888 Species:Drosophila melanogaster


Alignment Length:324 Identity:147/324 - (45%)
Similarity:219/324 - (67%) Gaps:31/324 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   485 VVLDDS-------PAPPAPFEHRVVSVKETSISAGYEVCQH-EVL---GGGRFGQVHRCTEKSTG 538
            :.:|||       ||.|         :::.:|:...:..:| :||   |.|:||.|::|.:|:.|
  Fly     2 IYIDDSEPEGVLEPAFP---------MRDVTINRNVDAHKHYDVLGEVGRGKFGTVYKCRDKANG 57

Human   539 LPLAAKIIKVKSAKDREDVKNEINIMNQLSHVNLIQLYDAFESKHSCTLVMEYVDGGELFDRITD 603
            |.||||.:.:...:|:.:|:.|:.|||.|.|..:||||.|:|.:....:|:|.::|||||||:.|
  Fly    58 LQLAAKFVPIPKREDKRNVEREVEIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVD 122

Human   604 EKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVNQTGHQIKIIDFGLARRYKPREK 668
            :::.|||....:|.||:||.:.::|.:.|:||||||||||.:.|.|::||||||||||::.|.::
  Fly   123 DEFVLTERVCRVFIRQVCEAMAFIHGNGIVHLDLKPENILVLTQKGNRIKIIDFGLARKFDPDKR 187

Human   669 LKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAETMNFIVNCSWDFDA 733
            |:|.||||||:||||||::.:|:.|||||||||.|:|:||||||:||.|.|||:.:....:||:.
  Fly   188 LRVLFGTPEFVAPEVVNFDCISYGTDMWSVGVICYVLISGLSPFMGENDIETMSNVTIAKYDFED 252

Human   734 DTFEGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWLNNLPAKA-----------SRSKTRLKS 786
            :.|.|:|.|..||:::||.|:.|.||:|.:|:||:||...||.|           :.||:||||
  Fly   253 ECFNGISPECLDFIAKLLAKDLSTRMTAAECMKHKWLQQRPATAATATPITKAASAASKSRLKS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYLK3NP_872299.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..334
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..462
STKc_MLCK3 510..770 CDD:271094 129/263 (49%)
S_TKc 513..770 CDD:214567 129/260 (50%)
sqaNP_001260832.1 S_TKc 34..289 CDD:214567 128/254 (50%)
STKc_MLCK 40..289 CDD:271005 126/248 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000818
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24347
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4277
SonicParanoid 1 1.000 - - X2697
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.