DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IL1RL1 and sax-3

DIOPT Version :9

Sequence 1:NP_057316.3 Gene:IL1RL1 / 9173 HGNCID:5998 Length:556 Species:Homo sapiens
Sequence 2:NP_001024990.1 Gene:sax-3 / 180637 WormBaseID:WBGene00004729 Length:1273 Species:Caenorhabditis elegans


Alignment Length:559 Identity:114/559 - (20%)
Similarity:187/559 - (33%) Gaps:188/559 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    31 ALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSP--T 93
            |::..|...|.|...:.|  .:.|:.:|. .|..:....:.|:......:|.|.|.|..|:|  |
 Worm   243 AVLFDCRVTGDPQPQITW--KRKNEPMPV-TRAYIAKDNRGLRIERVQPSDEGEYVCYARNPAGT 304

Human    94 FNRTGYANV----TIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTI----DLYNWTAPLE---W 147
            ...:.:..|    :...|.:|.:||        :|.  .:...|..:    ..|.|:...:   .
 Worm   305 LEASAHLRV
QAPPSFQTKPADQSVP--------AGG--TATFECTLVGQPSPAYFWSKEGQQDLL 359

Human   148 FKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLF- 211
            |.:..:..|....:....|.|:.|...|.|.|.|..: |..|::.|..|.: .|.|...|.:.. 
 Worm   360 FPSYVSADGRTKVSPTGTLTIEEVRQVDEGAYVCAGM-NSAGSSLSKAALK-VTTKAVTGNTPAK 422

Human   212 --PVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQ 274
              |.|....||:  .:.:|.:|.|.|.|. ||.|   ..:.|..:|..| |..:.||.|.     
 Worm   423 PPPTIEHGHQNQ--TLMVGSSAILPCQAS-GKPT---PGISWLRDGLPI-DITDSRISQH----- 475

Human   275 SFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHG---------LRRHT-----VRL------- 318
              |.|      .|.|||:|:.|..: |.|:|.|..|         :..||     ||:       
 Worm   476 --STG------SLHIADLKKPDTGV-YTCIAKNEDGESTWSASLTVEDHTSNAQFVRMPDPSNFP 531

Human   319 -SRKNPIDHHSIYCIIAVCSVFLMLINVLVIILKMFWIEATLLWRDIAKPYKTRNDGKLYDAYVV 382
             |...||                 ::||....:::.|                            
 Worm   532 SSPTQPI-----------------IVNVTDTEVELHW---------------------------- 551

Human   383 YPRNYKSSTDGASRVEHFVHQILPDVLENKCGYTLCIYGRDM------LPGEDVVTAVETNI--- 438
                ...||.||..:               .||.:..|..|:      :|  |.|.:.|..|   
 Worm   552 ----NAPSTSGAGPI---------------TGYIIQYYSPDLGQTWFNIP--DYVASTEYRIKGL 595

Human   439 RKSRRHIFIL---------TPQITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDMLQAE 494
            :.|..::|::         ||.::              .||:........:.:...:::||..||
 Worm   596 KPSHSYMFVIRAENEKGIGTPSVS--------------SALVTTSKPAAQVALSDKNKMDMAIAE 646

Human   495 ALQDSLQHLMKVQGTIKWREDHIANKRSLNSK----FWK 529
            ....| :.|:|::           ..:::||.    |||
 Worm   647 KRLTS-EQLIKLE-----------EVKTINSTAVRLFWK 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IL1RL1NP_057316.3 Ig 16..104 CDD:299845 17/78 (22%)
IG_like 21..104 CDD:214653 17/78 (22%)
Ig2_IL1R_like 118..204 CDD:143234 18/92 (20%)
IG_like 120..197 CDD:214653 16/83 (19%)
Flexible linker 198..211 3/12 (25%)
TIR 380..535 CDD:279864 31/172 (18%)
sax-3NP_001024990.1 Ig 30..129 CDD:299845
I-set 31..121 CDD:254352
I-set 135..223 CDD:254352
Ig2_Robo 137..223 CDD:143201
I-set 227..313 CDD:254352 16/72 (22%)
Ig 244..313 CDD:299845 15/71 (21%)
I-set 317..410 CDD:254352 21/104 (20%)
Ig 331..411 CDD:299845 17/83 (20%)
Ig 424..512 CDD:299845 32/108 (30%)
I-set 432..512 CDD:254352 30/100 (30%)
FN3 531..624 CDD:238020 25/172 (15%)
FN3 659..747 CDD:238020 5/15 (33%)
FN3 755..836 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.