DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACY3 and ntc

DIOPT Version :10

Sequence 1:XP_016874038.1 Gene:ACY3 / 91703 HGNCID:24104 Length:326 Species:Homo sapiens
Sequence 2:NP_647829.1 Gene:ntc / 38443 FlyBaseID:FBgn0035461 Length:314 Species:Drosophila melanogaster


Alignment Length:80 Identity:17/80 - (21%)
Similarity:29/80 - (36%) Gaps:16/80 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   262 LQPGAPIFQMFSGEDLLYEGESTV-YPVFINEAAYYEK--------------GVAFVQTEKFTFT 311
            :|| .|.|..|..:::....|... |.|..|:..|..:              .||.:|......:
  Fly   126 IQP-VPSFSSFHAQNVRILSEQPARYEVCFNDTVYIMRLRTLLDKHAPEETSLVAALQCRLMAVS 189

Human   312 VPAMPALTPAPSPAS 326
            :.....:|.:|:|.|
  Fly   190 LGDQLMITLSPAPPS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACY3XP_016874038.1 Peptidase_M14_like 11..307 CDD:472171 13/59 (22%)
ntcNP_647829.1 F-box-like 267..>298 CDD:463757
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.