| Sequence 1: | NP_001354424.1 | Gene: | ANKRD44 / 91526 | HGNCID: | 25259 | Length: | 1074 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_011748.3 | Gene: | NAS6 / 853147 | SGDID: | S000003464 | Length: | 228 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 218 | Identity: | 69/218 - (31%) |
|---|---|---|---|
| Similarity: | 104/218 - (47%) | Gaps: | 30/218 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Human 517 ELERARELKEKEATLCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLL---ERTNSGFE 578
Human 579 ESDSGATKSPLHLAAYNGHHQALEVLLQSLVDLDIRDE------KGRTALDLAAFKGHTECVEAL 637
Human 638 INQGASIFVKDNVTKRTPLHASVINGHTLCLRLLLEIADNPEAVDVKDAKGQTPLMLAVAYGHID 702
Human 703 AVSLLLEK-EANVDTVDILGCTA 724 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ANKRD44 | NP_001354424.1 | ANK 1 | 7..36 | ||
| ANK 2 | 40..69 | ||||
| ANK 3 | 73..102 | ||||
| ANK 4 | 106..135 | ||||
| ANK 5 | 139..168 | ||||
| ANK 6 | 172..201 | ||||
| ANK 7 | 205..234 | ||||
| ANK 8 | 238..267 | ||||
| ANK 9 | 271..301 | ||||
| ANK 10 | 305..334 | ||||
| ANK 11 | 338..367 | ||||
| ANK 13 | 422..451 | ||||
| ANK 14 | 455..484 | ||||
| ANK 15 | 488..516 | ||||
| ANK 16 | 549..579 | 6/32 (19%) | |||
| ANK 17 | 584..613 | 11/28 (39%) | |||
| ANK 18 | 617..646 | 12/28 (43%) | |||
| ANK 19 | 651..680 | 6/28 (21%) | |||
| ANK 20 | 687..716 | 15/29 (52%) | |||
| ANK 21 | 720..749 | 2/5 (40%) | |||
| ANK 22 | 753..782 | ||||
| ANK 23 | 789..818 | ||||
| ANK 24 | 821..850 | ||||
| ANK 25 | 856..885 | ||||
| ANK 26 | 889..919 | ||||
| ANK 27 | 923..952 | ||||
| ANK 28 | 959..988 | ||||
| NAS6 | NP_011748.3 | ANKYR | 1..226 | CDD:223738 | 69/218 (32%) |
| ANK repeat | 1..33 | CDD:293786 | 5/29 (17%) | ||
| ANK repeat | 35..69 | CDD:293786 | 6/33 (18%) | ||
| ANK repeat | 71..104 | CDD:293786 | 13/38 (34%) | ||
| ANK repeat | 107..137 | CDD:293786 | 12/29 (41%) | ||
| ANK repeat | 139..171 | CDD:293786 | 8/34 (24%) | ||
| ANK repeat | 173..205 | CDD:293786 | 16/31 (52%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_100012 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||