| Sequence 1: | NP_001354424.1 | Gene: | ANKRD44 / 91526 | HGNCID: | 25259 | Length: | 1074 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_010607.3 | Gene: | ASP1 / 851920 | SGDID: | S000002729 | Length: | 381 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 224 | Identity: | 46/224 - (20%) |
|---|---|---|---|
| Similarity: | 70/224 - (31%) | Gaps: | 56/224 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Human 862 HAAAFADHVECLQLLLRHSAPVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNT 926
Human 927 PLHLACSKGHEKCALLILDKIQD---------ESLINEKNNALQTPLHVAARNGLKVVVEELLAK 982
Human 983 GACVL--AVDENGHTPALACAPNKDVADCLALILATMMP---FSPSSTMMAVNFVCLKKDNLS-- 1040
Human 1041 RTTLSNLGSMVS----LCSNNVGSEDGYN 1065 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ANKRD44 | NP_001354424.1 | ANK 1 | 7..36 | ||
| ANK 2 | 40..69 | ||||
| ANK 3 | 73..102 | ||||
| ANK 4 | 106..135 | ||||
| ANK 5 | 139..168 | ||||
| ANK 6 | 172..201 | ||||
| ANK 7 | 205..234 | ||||
| ANK 8 | 238..267 | ||||
| ANK 9 | 271..301 | ||||
| ANK 10 | 305..334 | ||||
| ANK 11 | 338..367 | ||||
| ANK 13 | 422..451 | ||||
| ANK 14 | 455..484 | ||||
| ANK 15 | 488..516 | ||||
| ANK 16 | 549..579 | ||||
| ANK 17 | 584..613 | ||||
| ANK 18 | 617..646 | ||||
| ANK 19 | 651..680 | ||||
| ANK 20 | 687..716 | ||||
| ANK 21 | 720..749 | ||||
| ANK 22 | 753..782 | ||||
| ANK 23 | 789..818 | ||||
| ANK 24 | 821..850 | ||||
| ANK 25 | 856..885 | 6/22 (27%) | |||
| ANK 26 | 889..919 | 6/29 (21%) | |||
| ANK 27 | 923..952 | 5/37 (14%) | |||
| ANK 28 | 959..988 | 6/30 (20%) | |||
| ASP1 | NP_010607.3 | asnASE_II | 30..378 | CDD:273115 | 46/224 (21%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||