DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ANKRD44 and ASP3-1

DIOPT Version :9

Sequence 1:NP_001354424.1 Gene:ANKRD44 / 91526 HGNCID:25259 Length:1074 Species:Homo sapiens
Sequence 2:NP_013256.1 Gene:ASP3-1 / 850850 SGDID:S000004145 Length:362 Species:Saccharomyces cerevisiae


Alignment Length:362 Identity:74/362 - (20%)
Similarity:120/362 - (33%) Gaps:133/362 - (36%)


- Green bases have known domain annotations that are detailed below.


Human   239 GNTALHIACYNGQDAVVNELID------YGANVN--QPNNNGFTPLHF----------------- 278
            |:|:...|.|: ....||:||:      ..||::  |.:|.|...|::                 
Yeast    48 GSTSATTAGYS-VGLTVNDLIEAVPSLAEKANLDYLQVSNVGSNSLNYTHLIPLYHGISEALASD 111

Human   279 ---AAASTHG-------ALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEID 333
               .|..|||       |..|:|.:|:...|.|..  ...|...|:..|.....|.:     .|.
Yeast   112 DYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAG--AMRPATATSADGPMNLYQAV-----SIA 169

Human   334 CVDKDGNTPLHVAARYGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHS-DCCRKLLSSGQK 397
            ..:|        :...|..:.:|..|.||..|.|             :||:| |..|   :..|.
Yeast   170 ASEK--------SLGRGTMITLNDRIASGFWTTK-------------MNANSLDTFR---ADEQG 210

Human   398 YSIVSLFSNEH-------VLSAGFE------IDTPDKFGRTCLHAAAAGGNVECIK--------- 440
            |  :..|||:.       |...|::      :..|.:.....:..:..|.|.|.|.         
Yeast   211 Y--LGYFSNDDVEFYYPPVKPNGWQFFDISNLTDPSEIPEVIILYSYQGLNPELIVKAVKDLGAK 273

Human   441 --LLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNET--DDWGRTALHYAAASD- 500
              :|..|||.                         :...||:.|||.  :::|...:|....:| 
Yeast   274 GIVLAGSGAG-------------------------SWTATGSIVNEQLYEEYGIPIVHSRRTADG 313

Human   501 ----MDRNKTILGNAHDNSEELERARELKEKEATLCL 533
                .|..:..:|:.:.|.   :::|.|.:    |||
Yeast   314 TVPPDDAPEYAIGSGYLNP---QKSRILLQ----LCL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ANKRD44NP_001354424.1 ANK 1 7..36
ANK 2 40..69
ANK 3 73..102
ANK 4 106..135
ANK 5 139..168
ANK 6 172..201
ANK 7 205..234
ANK 8 238..267 10/35 (29%)
ANK 9 271..301 11/56 (20%)
ANK 10 305..334 5/28 (18%)
ANK 11 338..367 6/28 (21%)
ANK 13 422..451 8/39 (21%)
ANK 14 455..484 3/28 (11%)
ANK 15 488..516 6/32 (19%)
ANK 16 549..579
ANK 17 584..613
ANK 18 617..646
ANK 19 651..680
ANK 20 687..716
ANK 21 720..749
ANK 22 753..782
ANK 23 789..818
ANK 24 821..850
ANK 25 856..885
ANK 26 889..919
ANK 27 923..952
ANK 28 959..988
ASP3-1NP_013256.1 asnASE_II 9..359 CDD:273115 74/362 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.