DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ANKRD44 and res1

DIOPT Version :9

Sequence 1:NP_001354424.1 Gene:ANKRD44 / 91526 HGNCID:25259 Length:1074 Species:Homo sapiens
Sequence 2:NP_595496.1 Gene:res1 / 2541153 PomBaseID:SPBC725.16 Length:637 Species:Schizosaccharomyces pombe


Alignment Length:547 Identity:109/547 - (19%)
Similarity:192/547 - (35%) Gaps:181/547 - (33%)


- Green bases have known domain annotations that are detailed below.


Human    33 DVNT-LDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKH 96
            |||. :|.:..|.||.||.:|:.|::..|:.:||.|.|.:.:..|.|.|.|              
pombe   228 DVNAGIDEDGHTALHWAAAMGNLEMMHALLQAGANVVAVNYLQQTSLMRCV-------------- 278

Human    97 SADVNARDKNWQTPLHVAAANKAVKCAEVIIPLL-SSVNVSDRGGRTALHHAALNGHVEMVNLLL 160
                            :...|..::..||:..|| |::.::|..|:|..||.|         ||.
pombe   279 ----------------MFTMNYDLQTFEVVSELLQSAICMNDSFGQTVFHHIA---------LLA 318

Human   161 AKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQINVVKHL 225
            :..:.:.|           |.|  ::|::                    |....:...::|...:
pombe   319 SSKSKMEA-----------ARY--YMDIL--------------------LQNLTATQSVDVAAQI 350

Human   226 LNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLE 290
            :||..:      :|:|||.|...||.......|:.:.|:.:.|||.|..|..|.::.        
pombe   351 INLQDD------HGDTALLICARNGAKKCARLLLSFYASSSIPNNQGQYP
TDFLSSK-------- 401

Human   291 LLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDK--DGNTPL-HVAARYGHE 352
                   |::....| .|||:...       ...||.|......:|.  ....|: :.:.:..|:
pombe   402 -------DMSFPEND-DSPLNSKI-------EDNLIDNLKYPQSLDDHLSSKKPISYFSNKLTHQ 451

Human   353 LLINTLITSGADTAKCGIHSM------FPLHLAALN---AHSDCCRKL----LSSGQKYSIVSLF 404
            .|.| :.|..::.:||...|:      :.|.:.||.   ..::.|::|    .::.:.|.:    
pombe   452 TLPN-VFTQLSELSKCHEASLAEKQLTYNLAMEALEQTVRETETCQRLWNERTNNDENYLV---- 511

Human   405 SNEHVLSAGFEIDTPDKFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRTPLHYAAANCHF 469
             |:.               ...:|        :|.|.|.:.        |..|    |.......
pombe   512 -NQR---------------EDLIH--------QCKKFLHTL--------KTAR----YYLETVQL 540

Human   470 HCIETLVTTGANVNETDDWGRTALHYAAASDMDRNKTILGNAHD---NSEELERAREL----KEK 527
            |.::..||..:.:..||:          .:|:...|.::|  ||   |...|....|:    .|.
pombe   541 HQLKKYVTYFSQIWSTDE----------LADISETKNLVG--HDTKTNRSSLSSKHEVDLFTAEN 593

Human   528 EATLCLEFLLQNDANPSIRDKEGYNSI 554
            ||  ..|.|::...:...:.|:..|.|
pombe   594 EA--AREKLVEQLCSLQAQRKQKINEI 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ANKRD44NP_001354424.1 ANK 1 7..36 2/2 (100%)
ANK 2 40..69 11/28 (39%)
ANK 3 73..102 4/28 (14%)
ANK 4 106..135 6/29 (21%)
ANK 5 139..168 7/28 (25%)
ANK 6 172..201 3/28 (11%)
ANK 7 205..234 4/28 (14%)
ANK 8 238..267 9/28 (32%)
ANK 9 271..301 4/29 (14%)
ANK 10 305..334 7/28 (25%)
ANK 11 338..367 5/29 (17%)
ANK 13 422..451 4/28 (14%)
ANK 14 455..484 5/28 (18%)
ANK 15 488..516 6/30 (20%)
ANK 16 549..579 2/6 (33%)
ANK 17 584..613
ANK 18 617..646
ANK 19 651..680
ANK 20 687..716
ANK 21 720..749
ANK 22 753..782
ANK 23 789..818
ANK 24 821..850
ANK 25 856..885
ANK 26 889..919
ANK 27 923..952
ANK 28 959..988
res1NP_595496.1 KilA-N 26..102 CDD:282266
ANKYR 125..280 CDD:223738 20/81 (25%)
ANK 233..378 CDD:238125 46/222 (21%)
ANK repeat 236..304 CDD:293786 22/97 (23%)
Ank_2 241..329 CDD:289560 31/137 (23%)
ANK repeat 306..355 CDD:293786 15/90 (17%)
Ank_2 <351..>394 CDD:289560 15/48 (31%)
ANK repeat 357..388 CDD:293786 9/30 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.