DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACBD5 and anox

DIOPT Version :9

Sequence 1:XP_016872373.1 Gene:ACBD5 / 91452 HGNCID:23338 Length:609 Species:Homo sapiens
Sequence 2:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster


Alignment Length:283 Identity:62/283 - (21%)
Similarity:110/283 - (38%) Gaps:71/283 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   101 ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYKW 165
            :||.:|.|....|...|.:.....||..     :|.||.:|||||.||||...||......:.||
  Fly     4 SDTDTVDELFHLATEHVAKQSNSIGSAD-----LLIFYGYYKQATNGPCKEQSPGLLQLQAKSKW 63

Human   166 DAWSSLGDMTKEEAMIAYVEEMKKIIETMPMTEKVEELLRVIGPFYEIVEDKKSGRSSDITSVRL 230
            .||.:||.|::..|..|||::::                       |:..:.:|.|:.......:
  Fly    64 QAWRNLGTMSQSAARQAYVQKLQ-----------------------ELQPNWRSRRNPGWVVHSI 105

Human   231 EKISKCLEDLGNVLTSTPNAKTVNGKAESSDSGAESEEEEAQEEVKGAEQSDNDKKMMKKSADHK 295
            |.:.  |||           :.::.:....|...|:..:..:|.::.::....|:..|       
  Fly   106 ESVP--LED-----------QRLDSEKTLFDHVKENNLDRLRELLQPSDLVKLDEHGM------- 150

Human   296 NLEVIVTNGYDKDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVED 360
               .::....|::. |:.||..:.:.:|:|.|..|:..|              :|...:..|:|.
  Fly   151 ---ALIHWATDRNA-VEIIQFLVRSGASVNQRDAEQQTP--------------LHYAASCGHLEA 197

Human   361 VTGIQHLTS-----DSDSEVYCD 378
            :..:..|.:     |||.:...|
  Fly   198 LQCLLELHASLELRDSDGQTCYD 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACBD5XP_016872373.1 None
anoxNP_001027085.1 ACBP 10..90 CDD:279259 31/107 (29%)
ANK 125..231 CDD:238125 21/121 (17%)
Ank_2 125..212 CDD:289560 17/111 (15%)
ANK repeat 148..179 CDD:293786 7/41 (17%)
ANK repeat 181..212 CDD:293786 6/44 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.