powered by:
Protein Alignment RNF185 and CG34308
DIOPT Version :9
Sequence 1: | NP_689480.2 |
Gene: | RNF185 / 91445 |
HGNCID: | 26783 |
Length: | 192 |
Species: | Homo sapiens |
Sequence 2: | NP_001097770.3 |
Gene: | CG34308 / 5740483 |
FlyBaseID: | FBgn0085337 |
Length: | 194 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 22/72 - (30%) |
Similarity: | 42/72 - (58%) |
Gaps: | 0/72 - (0%) |
- Green bases have known domain annotations that are detailed below.
Human 21 SGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISR 85
||.::|..|....:|.:.|.:|:.||:...:|.|||.||..|::.|:.::..:..||.|::.|..
Fly 16 SGGNSGEEEDSWMNSYYTCLVCMQTAESPRVSFCGHHFCSQCIYNWIRSQKYQAKCPYCQSLIGE 80
Human 86 DKVIPLY 92
:.:|.::
Fly 81 NTLITIH 87
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000717 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12313 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.010 |
|
Return to query results.
Submit another query.