DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF185 and CG34308

DIOPT Version :9

Sequence 1:NP_689480.2 Gene:RNF185 / 91445 HGNCID:26783 Length:192 Species:Homo sapiens
Sequence 2:NP_001097770.3 Gene:CG34308 / 5740483 FlyBaseID:FBgn0085337 Length:194 Species:Drosophila melanogaster


Alignment Length:72 Identity:22/72 - (30%)
Similarity:42/72 - (58%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    21 SGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISR 85
            ||.::|..|....:|.:.|.:|:.||:...:|.|||.||..|::.|:.::..:..||.|::.|..
  Fly    16 SGGNSGEEEDSWMNSYYTCLVCMQTAESPRVSFCGHHFCSQCIYNWIRSQKYQAKCPYCQSLIGE 80

Human    86 DKVIPLY 92
            :.:|.::
  Fly    81 NTLITIH 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF185NP_689480.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 3/8 (38%)
Required for ubiquitin ligase activity and protection against ER stress-induced cell death. /evidence=ECO:0000269|PubMed:27485036 29..80 16/50 (32%)
RING-HC_RNF185 38..80 CDD:319658 14/41 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..123 0/3 (0%)
CG34308NP_001097770.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.