DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF185 and dgrn

DIOPT Version :10

Sequence 1:NP_689480.2 Gene:RNF185 / 91445 HGNCID:26783 Length:192 Species:Homo sapiens
Sequence 2:NP_649596.1 Gene:dgrn / 40725 FlyBaseID:FBgn0037384 Length:319 Species:Drosophila melanogaster


Alignment Length:89 Identity:20/89 - (22%)
Similarity:38/89 - (42%) Gaps:10/89 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    11 SPENS-----SAGGPSGSSNGAGESGGQDSTFECNICLDTA--KDAVISLCGHLFCWPCLHQWLE 68
            |.||.     ....|....|...:...::..::|.||:|:.  ::.|.:.|||:||..|:...:.
  Fly   233 SAENDPVVDLDVASPPKRVNRDIDESQKEELYKCPICMDSVSKREPVSTKCGHVFCRECIETAIR 297

Human    69 TRPNRQVCPVCKAGISRDKVIPLY 92
            .   ...||:|...::..:...:|
  Fly   298 A---THKCPICNKKLTARQFFRIY 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF185NP_689480.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 5/23 (22%)
Required for ubiquitin ligase activity and protection against ER stress-induced cell death. /evidence=ECO:0000269|PubMed:27485036 29..80 13/52 (25%)
RING-HC_RNF185 37..93 CDD:438402 15/58 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..123 1/3 (33%)
dgrnNP_649596.1 PEX10 <182..308 CDD:227861 19/77 (25%)
RING_Ubox 264..315 CDD:473075 14/53 (26%)

Return to query results.
Submit another query.