DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF185 and Pex10

DIOPT Version :10

Sequence 1:NP_689480.2 Gene:RNF185 / 91445 HGNCID:26783 Length:192 Species:Homo sapiens
Sequence 2:NP_647624.1 Gene:Pex10 / 38182 FlyBaseID:FBgn0035233 Length:299 Species:Drosophila melanogaster


Alignment Length:57 Identity:23/57 - (40%)
Similarity:37/57 - (64%) Gaps:3/57 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    35 STFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPL 91
            :|.:|.:||:...|:.::.|||:|||.||.:|||   .|..||:|:..:.:.:||.|
  Fly   242 NTPQCILCLEPRSDSSLTPCGHIFCWSCLLEWLE---ERDECPLCRESLKKSQVILL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF185NP_689480.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Required for ubiquitin ligase activity and protection against ER stress-induced cell death. /evidence=ECO:0000269|PubMed:27485036 29..80 19/44 (43%)
RING-HC_RNF185 37..93 CDD:438402 22/55 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..123 1/2 (50%)
Pex10NP_647624.1 Pex2_Pex12 20..>173 CDD:398431
HRD1 <183..>287 CDD:227568 20/47 (43%)
RING-HC_PEX10 244..295 CDD:438190 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.