DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF185 and CG32581

DIOPT Version :9

Sequence 1:NP_689480.2 Gene:RNF185 / 91445 HGNCID:26783 Length:192 Species:Homo sapiens
Sequence 2:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster


Alignment Length:223 Identity:109/223 - (48%)
Similarity:132/223 - (59%) Gaps:40/223 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     6 PSASASPENSSA------------------GGPSGSSNGAGESGG------------------QD 34
            |..::.|.||:|                  ||......|....||                  .|
  Fly    56 PLGTSIPTNSTASELKKSNTSYSFTGDYLSGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTADD 120

Human    35 STFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCPVCKAGISRDKVIPLYGRGSTGQ 99
            |.:|||||||||||||:|:||||||||||||||.|||||::||||||.:.:|||||||||.||.|
  Fly   121 SLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTHQ 185

Human   100 QDPREKTPPRPQGQRPEPENRGGFQGFGFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPG 164
            :|||.|.||||.|||.||:...||.|||||| ||.|||||||||||...:..|..:.|||..:  
  Fly   186 EDPRNKVPPRPAGQRTEPDPVPGFPGFGFGD-GFHMSFGIGAFPFGFITSRLNFFEPRPPADI-- 247

Human   165 TPQYVDEQF-LSRLFLFVALVIMFWLLI 191
            ...:.||.: ||:||....:.:::.||:
  Fly   248 RRLHEDEPWALSKLFWHFVVFVIYGLLV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF185NP_689480.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 8/41 (20%)
Required for ubiquitin ligase activity and protection against ER stress-induced cell death. /evidence=ECO:0000269|PubMed:27485036 29..80 40/68 (59%)
RING-HC_RNF185 38..80 CDD:319658 36/41 (88%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..123 21/32 (66%)
CG32581NP_001096988.2 RING 124..169 CDD:238093 39/44 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152552
Domainoid 1 1.000 138 1.000 Domainoid score I4857
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H34298
Inparanoid 1 1.050 239 1.000 Inparanoid score I3357
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 1 1.000 - - otm42177
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.