DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RCCD1 and CG8060

DIOPT Version :10

Sequence 1:NP_291022.2 Gene:RCCD1 / 91433 HGNCID:30457 Length:376 Species:Homo sapiens
Sequence 2:NP_611117.2 Gene:CG8060 / 36824 FlyBaseID:FBgn0034113 Length:1189 Species:Drosophila melanogaster


Alignment Length:235 Identity:56/235 - (23%)
Similarity:96/235 - (40%) Gaps:47/235 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   145 SPRA-PFYRPLAPELRARQLELGAEHALLLDAAGQVFSWGGGRHGQLGHG---TLEAELEPRLLE 205
            :|:| .|:|  ...|...|:.|||.|:|..|..|.:::.|.|:.|:||.|   :|.|....::..
  Fly   169 TPQAVDFFR--KSNLWLEQVALGAYHSLFCDKKGHLYAVGHGKGGRLGIGLENSLPAPKRVKVSS 231

Human   206 ALQGLVMAEVAAGGWHSVCVSETGDIYIWGWNESGQLALPTRNLAEDGETVAREATELNEDGSQV 270
            .|.|..:..::....||:.::....::..|.|...||.:  |:.||. .|..:|...|.:.|:  
  Fly   232 KLSGDSIQCISVSRQHSLVLTHQSLVFACGLNTDHQLGV--RDAAEQ-LTQFKEVVALRDKGA-- 291

Human   271 KRTGGAEDGAPAPFIAVQPFPALLDLPMGSDAVKA-SCGSRHTAVVTRTGELYTWGWGKYGQLG- 333
                                         ||.|:. :|.....|..:|.  :|.|| ...||.| 
  Fly   292 -----------------------------SDLVRVIACDQHSIAYGSRC--VYVWG-ANQGQFGI 324

Human   334 HEDTTSLDRPRRVEYFVDKQLQVKAVTCGPWNTYVYAVEK 373
            :.:|.|:..|..::  :..:..::.|......|.:|..||
  Fly   325 NSNTPSITVPTLIK--LPAKTTIRFVEANNAATVIYNEEK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RCCD1NP_291022.2 Interaction with KDM8. /evidence=ECO:0000269|PubMed:24981860 1..169 9/24 (38%)
ATS1 <160..368 CDD:444065 48/212 (23%)
RCC1 2 176..227 13/53 (25%)
RCC1 3 229..317 16/88 (18%)
RCC1 4 318..371 12/53 (23%)
CG8060NP_611117.2 ANKYR <51..141 CDD:440430
ANK repeat 56..87 CDD:293786
ANK repeat 89..121 CDD:293786
ATS1 140..>355 CDD:444065 52/226 (23%)
BTB_POZ 543..643 CDD:453885
BTB2_POZ_IBtk 691..802 CDD:349611
BACK_IBtk 798..857 CDD:350575
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.