DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCNB2 and CycB3

DIOPT Version :9

Sequence 1:NP_004692.1 Gene:CCNB2 / 9133 HGNCID:1580 Length:398 Species:Homo sapiens
Sequence 2:NP_001262934.1 Gene:CycB3 / 42971 FlyBaseID:FBgn0015625 Length:575 Species:Drosophila melanogaster


Alignment Length:405 Identity:123/405 - (30%)
Similarity:197/405 - (48%) Gaps:67/405 - (16%)


- Green bases have known domain annotations that are detailed below.


Human     4 LRRPTVSS--DLENIDTGVNSKVKSHVTIRRTVLEEI---------GNRVTTRAAQVAKKAQNTK 57
            |..|.|::  .:..|....|   |:..::..:.||::         ||....| .:.||..|.|:
  Fly   200 LAAPQVAAVKPVRRISNDFN---KTEDSLYMSALEDVSSCDSMRLSGNFEAAR-RRSAKLQQKTE 260

Human    58 VPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDN 122
            ...||...|     |..||   |.|:..:     .|.||:|                   ||.|.
  Fly   261 QQPQPLLLT-----LPETA---PSQVVPI-----PPVPEEV-------------------EDFDR 293

Human   123 EDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETL 187
            ::|::|...|.|..||:.||:..|....|..:......:...||.:||||:|:|...|.|..|||
  Fly   294 KNWDDPFQVSHYAMDIFNYLKVREAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETL 358

Human   188 YMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETL 252
            |:.|.|:|.:|..:.::::||||:|..|..:|.||:|...|.||||:||.|.||...::..||..
  Fly   359 YLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERE 423

Human   253 ILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQ 317
            .|:.:|::||.||...||||.::..:|.:...|||:|::||:|:||..:.:..|::|:||..::.
  Fly   424 TLRVIKYDLGIPLSYRFLRRYARCAKVPMPTLTLARYILELSLMDYANISFSDSQMASAALFMAL 488

Human   318 KVLGQGKWNLKQQ-------YYTGYTENEVLEVMQHMAKNVVKVNENLTK-----FIAIKNKYAS 370
            ::.| |...|.:|       |||||...:..|:       |..:|..|.:     ...|:|||:.
  Fly   489 RMHG-GPGQLDKQTWTSTLIYYTGYQLADFAEI-------VTALNAGLHRKPRATIKTIRNKYSH 545

Human   371 SKLLKISMIPQLNSK 385
            ....:::.:|.|.::
  Fly   546 KIFHEVAKVPLLTNQ 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCNB2NP_004692.1 Cyclin_N 137..262 CDD:278560 48/124 (39%)
Cyclin_C 264..382 CDD:281044 38/129 (29%)
CycB3NP_001262934.1 Cyclin_N 308..433 CDD:278560 48/124 (39%)
Cyclin_C 435..555 CDD:281044 37/127 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D475911at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R194
SonicParanoid 1 1.000 - - X94
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.