DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC16A3 and CG8389

DIOPT Version :9

Sequence 1:NP_001035887.1 Gene:SLC16A3 / 9123 HGNCID:10924 Length:465 Species:Homo sapiens
Sequence 2:NP_611076.2 Gene:CG8389 / 36764 FlyBaseID:FBgn0034063 Length:471 Species:Drosophila melanogaster


Alignment Length:481 Identity:111/481 - (23%)
Similarity:184/481 - (38%) Gaps:86/481 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    16 PDGGWGWAVLFGCFVITGFSYAFPKAVSVFFKELIQEFGIGYSDT---AWISSILLAMLYGTGPL 77
            ||||:||.|:....:|...:.:.   :|||.:..:.|......||   |.|:::....|..:|..
  Fly    10 PDGGYGWIVVAAVALINMTNQSI---LSVFGQLFVGELQKMQEDTFTAALITNLNSLALNFSGLF 71

Human    78 CSVCVNRFGCRPVMLVGGLFASLGMVAASFCRSIIQVYLTTGVITGLGLALNFQPSLIM-LNRYF 141
            ....:..|..|.|...|.:..:||:...:|........|......|.||.| ..||..| :|.||
  Fly    72 IGPAIKSFKPRNVAATGCILVALGLALCAFASESWHFILGYSFFVGFGLGL-ISPSTFMAINSYF 135

Human   142 SKRRPMANGLAAAGSPVFLCALSPLGQLLQDRYGWRGGFLILGGLLLNCCVCAALMRPL------ 200
            :.:|..|.|::.||:.:....:..|.:.|.|.:|:|...|.:..|.|.....||.::||      
  Fly   136 TTKRGRAVGVSLAGAGLGQVLIPHLVRYLLDNHGFRYAVLSMSSLSLFGLFGAAFLKPLNPPAKH 200

Human   201 -------VVTAQPGS-------------------GPP-------RPSRRL---LDLSVFRDRGF- 228
                   ::|...|.                   .||       |..:||   :||.:.:|..| 
  Fly   201 NNRKHIRLLTEADGEKTSPLQVVIVPTNQSKIERSPPNVDTLCSRMGQRLVQAMDLELLKDLVFW 265

Human   229 ---VLYAVAASVMVLGLFVPPVFVVSYAKDLGVPDTKAAFLLTILGFIDIFARPAAGFVAGLGKV 290
               |..|:..:..:....:.|.|:...|:   :.....||.::::...||..|.....|....::
  Fly   266 SIIVGMALVYTATINFTMIFPGFLGQTAQ---LNSQMVAFCMSLVAGADIVFRLLLPIVTDHLRI 327

Human   291 RPYSVYLFSFSMFFNGLADL--AGSTAGDYGGLVVFCIFFGISYGMVGALQFEVLMAIVGTH--- 350
             ||.|      :|..|:..|  |.....:...|.|. |...:..||:.:.........:..|   
  Fly   328 -PYRV------VFLIGIVGLFVARCVLAENQTLPVI-ITMSVLTGMMKSATVINNNLTISAHCRS 384

Human   351 -KFSSAIGLVLLMEAVAVLVGPPSGGKLL-------DATHVYMY---VFILAGAEVLTSSLILLL 404
             |.:..:||.::.:.|.|:    :.|:||       |:..:.:|   |.:|....|.|..::...
  Fly   385 EKLAGGLGLSMMSKGVIVI----TVGQLLGWVRDYADSYLICLYAQGVILLVVVLVWTPEILYRH 445

Human   405 GNFFCIRKKPKEPQPEVAAAEEEKLH 430
            ....|...|..|.| .:.|||..||:
  Fly   446 RRQRCATNKSMETQ-SIDAAEVAKLN 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC16A3NP_001035887.1 2A0111 8..444 CDD:331689 111/481 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..438 5/12 (42%)
CG8389NP_611076.2 MFS 19..425 CDD:119392 90/424 (21%)
MFS_1 19..400 CDD:284993 84/395 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916876at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11360
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.