DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCARF2 and F46B3.15

DIOPT Version :9

Sequence 1:NP_699165.3 Gene:SCARF2 / 91179 HGNCID:19869 Length:871 Species:Homo sapiens
Sequence 2:NP_507984.2 Gene:F46B3.15 / 185837 WormBaseID:WBGene00009766 Length:149 Species:Caenorhabditis elegans


Alignment Length:161 Identity:43/161 - (26%)
Similarity:56/161 - (34%) Gaps:42/161 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    29 LLLLLLWMLPDTVAPQELNPRGRNVCRAPGSQVPTCCAGWRQQGDECGIAVCEGNSTCSENEVCV 93
            |.|||:..:...|||       .:|..||..          .:|..|||..|.....|...: ||
 Worm     3 LCLLLIEAVGARVAP-------ASVVLAPVD----------SEGQHCGIVECRPGYDCVGGK-CV 49

Human    94 R--PGEC---RCRHGYFGANCDTKCPRQFWGP---DCKELC---SCHPHGQCEDVTGQCTCHARR 147
            :  |..|   :|:.||   .|..|..:....|   ...:||   :|.....|..|.|:..|..| 
 Worm    50 KDYPNSCTTIKCQAGY---QCTIKNGKGGCYPVSNKSLDLCVFTTCPKMSSCIVVDGKAKCVPR- 110

Human   148 WGARCEHAC---QCQHG-TCHPRSGACRCEP 174
                 ...|   ||..| .|..|:|...|.|
 Worm   111 -----SPPCTIKQCPKGQKCGLRNGLSTCVP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCARF2NP_699165.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PHA03247 <534..871 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 570..871
F46B3.15NP_507984.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.