DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment SCARF2 and dsl-1

DIOPT Version :9

Sequence 1:	NP_699165.3	Gene:	SCARF2 / 91179	HGNCID:	19869	Length:	871	Species:	Homo sapiens
Sequence 2:	NP_500054.1	Gene:	dsl-1 / 176939	WormBaseID:	WBGene00001103	Length:	252	Species:	Caenorhabditis elegans

Alignment Length:	142	Identity:	33/142 - (23%)
Similarity:	43/142 - (30%)	Gaps:	53/142 - (37%)

- Green bases have known domain annotations that are detailed below.

Human   230 QCRERTFGARCDRYC-----QCFRGRCHPVDGTCACEPGYRGKYCREPCPAGFYGLGCR-RRCGQ 288
            :|.....|..||.:|     :....|| ..:||..|..|:.|..|..|.||.    .|: :..|:
Worm   121 KCNRYWHGLHCDHFCNDDFARTINRRC-TQNGTLGCLEGFHGPNCELPVPAD----SCKCQNGGK 180

Human   289 CKGQQPCTVAEGRCLTCEPGWNGTKCDQPCATGFYGEGCSHRCPPCRDGHACNHVTGKCTRCNAG 353
            |......|.|:...|.||                           ||.||
Worm   181 CVSSLENTWAQNGSLICE---------------------------CRLGH--------------- 203

Human   354 WIGDRCETKCSN 365
            :.|..||.|..|
Worm   204 FEGKHCEKKSFN 215

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
SCARF2	NP_699165.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..20
		PHA03247	<534..871	CDD:223021
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	570..871
dsl-1	NP_500054.1	DSL	112..164	CDD:302925	12/43 (28%)
dsl-1	NP_500054.1	EGF_CA	<175..210	CDD:238011	12/76 (16%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1218
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900