DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC25A46 and Slc25a46

DIOPT Version :10

Sequence 1:NP_620128.1 Gene:SLC25A46 / 91137 HGNCID:25198 Length:418 Species:Homo sapiens
Sequence 2:NP_080441.1 Gene:Slc25a46 / 67453 MGIID:1914703 Length:418 Species:Mus musculus


Alignment Length:43 Identity:8/43 - (18%)
Similarity:20/43 - (46%) Gaps:4/43 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    36 RLNVHDYTTFGNTWNQAIQLSQSMNHRISELSTHFKVFYAQGR 78
            |.|:.|....|:..:..:::::.....:.    |:::..|.||
Mouse   401 RTNITDVYCAGDLTSFPLKMAKGQKVSLG----HWQIAQAHGR 439

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
SLC25A46NP_620128.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..93 5/35 (14%)
Solcar 1 96..187
Solcar 2 311..413
Mito_carr 317..402 CDD:395101
Slc25a46NP_080441.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..96
Solcar 1 96..187
Solcar 2 311..413 4/11 (36%)