DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RGN and yellow-f

DIOPT Version :10

Sequence 1:NP_004674.1 Gene:RGN / 9104 HGNCID:9989 Length:299 Species:Homo sapiens
Sequence 2:NP_524335.1 Gene:yellow-f / 41595 FlyBaseID:FBgn0041710 Length:429 Species:Drosophila melanogaster


Alignment Length:58 Identity:17/58 - (29%)
Similarity:20/58 - (34%) Gaps:21/58 - (36%)


- Green bases have known domain annotations that are detailed below.


Human   180 YDLQTGQI---------------------SNRRSVYKLEKEEQIPDGMCIDAEGKLWV 216
            ||.:||.|                     .|..|||....|...|..:.||.||.:||
  Fly   335 YDPRTGVIFFAEVQKSGVGCWKTSKPFSTENHGSVYSNSSEMIYPSDLTIDEEGYIWV 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RGNNP_004674.1 SGL 16..264 CDD:462480 17/58 (29%)
yellow-fNP_524335.1 MRJP 140..428 CDD:308585 17/58 (29%)

Return to query results.
Submit another query.