DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCGR2C and zgc:154125

DIOPT Version :9

Sequence 1:NP_963857.3 Gene:FCGR2C / 9103 HGNCID:15626 Length:323 Species:Homo sapiens
Sequence 2:XP_005170695.1 Gene:zgc:154125 / 768188 ZFINID:ZDB-GENE-061013-717 Length:426 Species:Danio rerio


Alignment Length:279 Identity:70/279 - (25%)
Similarity:103/279 - (36%) Gaps:74/279 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    49 KAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTC 113
            |.|:.|.|::..|...|.|||.|:|..:|..    |..||...|.............:::|:|.|
Zfish    21 KPVVSLRPRFPQVYVGDDVTLICKGGSNPTK----WVINGIEQPHQNDVMLLTTVTPHNNGQYEC 81

Human   114 -QTGQTSLSDPVHLTVL-SEWLVLQTPH-----LEFQEGETIVLR------CHSWKDKPLVKVTF 165
             |.|:.  ||||.|||| .|.|...:|.     :...||..:||:      .|:||       .|
Zfish    82 EQNGEK--SDPVPLTVLVLEALAQLSPSVGGSVISKGEGRNLVLQVDDAEELHNWK-------CF 137

Human   166 FQNGKSK-KFSRSDPNFSIPQA------NHSHSGDYHCTGNIGYTLYSSKPVTITVQ------AP 217
            ...||.: |..|.|.|..:.:|      ..:....:.|...  ...:.|..||:.:.      .|
Zfish   138 AFRGKREFKLDRIDVNKKLKRAVIFAELKDAERATFWCLNK--NATHRSNAVTLKITDKLVMLEP 200

Human   218 SSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEE 282
            .::|              |::...|||      |..|...:.|:.|.|.   :..|.|    |:.
Zfish   201 PAAP--------------ALLGDSVAL------RCVAWGAEKVEKATFY---KNQIEI----PDI 238

Human   283 TNNDYETADGGYMTLNPRA 301
            |.:.|.      :|..|.|
Zfish   239 TADTYN------ITATPEA 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCGR2CNP_963857.3 Ig1_FcgammaR_like 50..128 CDD:143229 25/78 (32%)
IG_like 56..128 CDD:214653 23/72 (32%)
Ig2_FcgammaR_like 132..214 CDD:143230 21/99 (21%)
IG_like 138..214 CDD:214653 20/93 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 277..323 6/25 (24%)
zgc:154125XP_005170695.1 Ig 22..95 CDD:299845 25/78 (32%)
IG_like 33..95 CDD:214653 22/67 (33%)
Ig 197..269 CDD:299845 19/88 (22%)
IG_like 200..270 CDD:214653 19/85 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I12521
NCBI 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.