DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FCGR2C and bdl

DIOPT Version :9

Sequence 1:NP_963857.3 Gene:FCGR2C / 9103 HGNCID:15626 Length:323 Species:Homo sapiens
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:297 Identity:64/297 - (21%)
Similarity:103/297 - (34%) Gaps:78/297 - (26%)


- Green bases have known domain annotations that are detailed below.


Human     2 GILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKL-EPQWINVLQED 65
            |.||..|.:.::....:||.....|.:....|.|.:...|....|||:..|.. :|         
  Fly   207 GSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPYGQP--------- 262

Human    66 SVTLTCRGTHSPESDSIPWFHNGNLIPTHTQPSYRFKAN---------NNDSGEYTC----QTGQ 117
             ..|.|....:|...::.|..:|.|..::..|...:|.|         .|.:|.|||    ..|.
  Fly   263 -AVLDCHFRANPPLKNLRWEKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDLGT 326

Human   118 TSLSDPVHLTVLSEWLVLQTPHLEFQE--GETIVLRCHS------------W--KD-KPLVKVTF 165
            ...|..:.:.||...:...||...:.:  ||...|.|.:            |  || :||     
  Fly   327 DGPSPVISVIVLRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQPL----- 386

Human   166 FQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVT 230
                .:.:||.|..|.:|........|.|.|:.       :::..|||.:|.         .::.
  Fly   387 ----PADRFSLSGGNLTITGLVEGDRGIYECSA-------TNEAATITAEAE---------LMIE 431

Human   231 GIAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEP 267
            .||..|            ...::||||:.....:::|
  Fly   432 NIAPRA------------PYNLTANSTETCITIRWQP 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FCGR2CNP_963857.3 Ig1_FcgammaR_like 50..128 CDD:143229 18/91 (20%)
IG_like 56..128 CDD:214653 17/84 (20%)
Ig2_FcgammaR_like 132..214 CDD:143230 21/98 (21%)
IG_like 138..214 CDD:214653 20/92 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 277..323
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352 9/34 (26%)
Ig 157..242 CDD:299845 9/34 (26%)
Ig_2 252..337 CDD:290606 20/94 (21%)
IG_like 260..327 CDD:214653 16/76 (21%)
I-set 341..428 CDD:254352 23/111 (21%)
IGc2 356..419 CDD:197706 17/78 (22%)
FN3 435..524 CDD:238020 6/34 (18%)
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.