DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ESAM and beat-Ia

DIOPT Version :9

Sequence 1:NP_620411.2 Gene:ESAM / 90952 HGNCID:17474 Length:390 Species:Homo sapiens
Sequence 2:NP_001285975.1 Gene:beat-Ia / 34947 FlyBaseID:FBgn0013433 Length:437 Species:Drosophila melanogaster


Alignment Length:191 Identity:46/191 - (24%)
Similarity:74/191 - (38%) Gaps:39/191 - (20%)


- Green bases have known domain annotations that are detailed below.


Human     9 VTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGE-VVLPAWYTLHGEVSSSQPW-----E 67
            :|.:|..|.|.::|    :...:::.:|    .||...| .:|..:|.:..:...|..|     |
  Fly    12 LTTILLALTLEMTA----ALRDVRVRVP----HAVRRSEKAILKCFYDIEDDSLYSVKWYKGRRE 68

Human    68 VPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQD 132
                  |::...||...:...:     .|||. |..:.|....:.|:.:....||.|||.|:.. 
  Fly    69 ------FYRYTPKETPPMKVFH-----FPGVK-VRRVSSNESQVVLDAVTMATSGKYSCEVSAD- 120

Human   133 KQGKSRGHSIKTL----ELNVLVPP--APPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQW 187
                  ..|..||    ||.|:..|  ||....::....||..:..:|.|..|:||....|
  Fly   121 ------APSFHTLIAAAELEVIETPHNAPFITGIRPRYRVGDILRGNCTSRHSRPAANLTW 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ESAMNP_620411.2 V-set 40..150 CDD:311561 28/119 (24%)
IG_like 166..241 CDD:214653 8/22 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..368
beat-IaNP_001285975.1 Ig 32..118 CDD:299845 23/101 (23%)
Ig 161..240 CDD:299845 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.