DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ESAM and side-II

DIOPT Version :9

Sequence 1:NP_620411.2 Gene:ESAM / 90952 HGNCID:17474 Length:390 Species:Homo sapiens
Sequence 2:NP_001014485.3 Gene:side-II / 3346206 FlyBaseID:FBgn0259213 Length:1064 Species:Drosophila melanogaster


Alignment Length:339 Identity:71/339 - (20%)
Similarity:116/339 - (34%) Gaps:118/339 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    34 HLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWE-VPFVMWF------------FKQKEKEDQVL 85
            |:....:.||||..|.||...|        :|.: |..|:||            .:.||..:|..
  Fly    51 HVKTKDIDAVEGKSVSLPCPIT--------EPLDNVYMVLWFRDNAGIPLYSFDVRDKESREQPR 107

Human    86 SYINGVTTSKP---GVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLEL 147
            .:      |.|   |....:...|:..:|.   ::..|.|.|.|.|:.:..|.:|     ....|
  Fly   108 HW------SAPEVFGSRAKFHFDSQPATLE---IKRHDQGIYRCRVDFRTSQTQS-----FRFNL 158

Human   148 NVLVPPAPP------SCRLQGV----PHVGANVTLSCQSPRSKPAVQYQW-------DRQLPSFQ 195
            :|::.|..|      ..:|.|.    ...|.::.::|:....:|..|.:|       |.|...  
  Fly   159 SVIILPEQPIIMDRWGRQLNGTQLGPKQEGDDIVITCRVVGGRPQPQVRWLVNGLLVDNQNEH-- 221

Human   196 TFFAPALDVIRGSLSLTNLS-SSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLV 259
                .:.|||...|...::. :.:..|:.|:|.|    .|.:...|.|                 
  Fly   222 ----NSGDVIENRLLWPSVQRNDLNSVFTCQALN----TQLDKPKEKS----------------- 261

Human   260 GLGLLAGLVLLYHRRG---KALEEPANDI--------------KEDAIAPRTLPWPK-------S 300
                   .:|..|.:.   |.||.|::.|              :.:||    :.|.|       :
  Fly   262 -------FILDMHLKPLVVKILEPPSSMIADRRYEVSCESSGSRPNAI----ITWYKGKRQLRRT 315

Human   301 SDTISKNGTLSSVT 314
            .|.||||.|.|.::
  Fly   316 KDDISKNSTRSELS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ESAMNP_620411.2 V-set 40..150 CDD:311561 29/125 (23%)
IG_like 166..241 CDD:214653 16/82 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..368
side-IINP_001014485.3 IG_like 55..160 CDD:214653 29/126 (23%)
Ig 57..160 CDD:299845 29/124 (23%)
Ig 188..251 CDD:299845 14/68 (21%)
Ig 289..363 CDD:299845 11/45 (24%)
IG_like 289..351 CDD:214653 11/45 (24%)
Ig_2 376..460 CDD:290606
IG_like 383..454 CDD:214653
Ig 470..548 CDD:299845
IG_like 481..557 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.