DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UNC119 and PrBP

DIOPT Version :10

Sequence 1:NP_005139.1 Gene:UNC119 / 9094 HGNCID:12565 Length:240 Species:Homo sapiens
Sequence 2:NP_609246.1 Gene:PrBP / 34196 FlyBaseID:FBgn0032059 Length:151 Species:Drosophila melanogaster


Alignment Length:134 Identity:29/134 - (21%)
Similarity:61/134 - (45%) Gaps:27/134 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    93 IRDMDSGTVLFEIKK---PPVSE---RLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTV 151
            :||.|||.::::..|   .|..|   |:|:.                   .|.:|.|...:.|:.
  Fly    23 LRDADSGKIIWQENKDFSAPDQEHEARVPVK-------------------ILDMRAVSREINFST 68

Human   152 GDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQS 216
            .:. :.|||:.::..|:.::::.:.|..||...::.||.:...:..|.|:.:.::::......|:
  Fly    69 IES-MENFRLDQKVLFKGRIMEEWFFEMGFVGANTTNTWQSTIEAAPESQMMPAKVLNGNVTIQT 132

Human   217 DSFY 220
             |||
  Fly   133 -SFY 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UNC119NP_005139.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..61
Required for midbody localization 1..59
GMP_PDE_delta 81..236 CDD:428436 29/134 (22%)
Required for centrosome localization 121..240 19/100 (19%)
PrBPNP_609246.1 GMP_PDE_delta 11..150 CDD:428436 29/134 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.